KEGG   Homo sapiens (human): 55255
Entry
55255             CDS       T01001                                 

Gene name
WDR41, MSTP048
Definition
(RefSeq) WD repeat domain 41
  KO
K23610  WD repeat-containing protein 41
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06413  Autophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55255 (WDR41)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55255 (WDR41)
   05022 Pathways of neurodegeneration - multiple diseases
    55255 (WDR41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55255 (WDR41)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Rab associated proteins
    55255 (WDR41)
SSDB
Motif
Pfam: WD40 DUF5793
Other DBs
NCBI-GeneID: 55255
NCBI-ProteinID: NP_060738
OMIM: 617502
HGNC: 25601
Ensembl: ENSG00000164253
Vega: OTTHUMG00000102169
Pharos: Q9HAD4(Tbio)
UniProt: Q9HAD4 A0A0S2Z5E0
LinkDB
Position
5q13.3-q14.1
AA seq 459 aa
MLRWLIGGGREPQGLAEKSPLQTIGEEQTQNPYTELLVLKAHHDIVRFLVQLDDYRFASA
GDDGIVVVWNAQTGEKLLELNGHTQKITAIITFPSLESCEEKNQLILTASADRTVIVWDG
DTTRQVQRISCFQSTVKCLTVLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALV
EIPKNCVVAAVGKELIIFRLVAPTEGSLEWDILEVKRLLDHQDNILSLINVNDLSFVTGS
HVGELIIWDALDWTMQAYERNFWDPSPQLDTQQEIKLCQKSNDISIHHFTCDEENVFAAV
GRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWELREKQQLAAE
PVPTGFFNMWGFGRVSKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLV
TCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYLAV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgttgcgatggctgatcgggggaggccgagaaccgcagggactggccgagaaatctcct
ttacagacaataggtgaagaacaaacccagaatccctacactgaactgctagtactgaag
gctcatcatgatattgtacgatttctggtacagttagatgactacagatttgcatctgct
ggtgatgatggaattgtagttgtgtggaatgcccagacaggggaaaaacttttagaactg
aatggacacactcaaaagataacagctattattacatttccttccttggaatcttgtgaa
gagaaaaatcaactcatcttgacagcctctgctgatagaacagttattgtgtgggatggt
gatactaccagacaagttcagagaatatcatgcttccagtctactgtaaagtgtttaact
gttcttcagagactagatgtttggctttctggtgggaatgacctgtgtgtgtggaaccga
aaattagatctcctgtgtaagactagccacctttctgatacaggtattagtgctttggtt
gaaatacctaagaactgtgttgtggcagcagttggcaaagaactgataattttcaggttg
gtagcacccacagaaggatcactagaatgggatattcttgaagttaagcgcctccttgat
caccaggataatattctctcattgattaatgtcaatgatttgagttttgtcaccggctcc
cacgtcggagagctgatcatctgggatgccctggactggaccatgcaggcctatgaacgc
aacttctgggacccatctccacaactggacacccaacaagaaataaaactctgtcaaaaa
tcaaatgacatttctattcatcatttcacatgtgatgaagagaatgtatttgctgcagtt
ggaaggggtttatacgtgtatagccttcaaatgaagcgtgtgattgcctgccagaaaact
gcacatgactccaatgtcctgcacgttgccagacttccaaacaggcagttaatctcatgc
tcagaagatggcagtgtacgcatttgggagttaagagaaaaacagcagcttgcagctgag
cctgtaccaacaggtttttttaacatgtggggatttggaagagtcagcaaacaagccagc
caacctgttaaaaagcagcaagaaaatgctacttcatgttcactggagcttattggagat
ttgattggacactcatcatctgtggagatgtttctatactttgaagatcatggactagtg
acgtgctccgctgatcatctcattattttgtggaaaaatggagagcgagaatctggattg
cgcagtttaagattatttcaaaaattagaggagaatggtgacttataccttgctgtctag

DBGET integrated database retrieval system