KEGG   Homo sapiens (human): 55503
Entry
55503             CDS       T01001                                 

Gene name
TRPV6, ABP/ZF, CAT1, CATL, ECAC2, HRPTTN, HSA277909, LP6728, ZFAB
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 6
  KO
K04975  transient receptor potential cation channel subfamily V member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    55503 (TRPV6)
   04978 Mineral absorption
    55503 (TRPV6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    55503 (TRPV6)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   55503 (TRPV6)
SSDB
Motif
Pfam: Ank_2 Ion_trans Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 55503
NCBI-ProteinID: NP_061116
OMIM: 606680
HGNC: 14006
Ensembl: ENSG00000165125
Vega: OTTHUMG00000157158
Pharos: Q9H1D0(Tchem)
UniProt: Q9H1D0
LinkDB
Structure
PDB: 

Position
7q34
AA seq 765 aa
MGPLQGDGGPALGGADVAPRLSPVRVWPRPQAPKEPALHPMGLSLPKEKGLILCLWSKFC
RWFQRRESWAQSRDEQNLLQQKRIWESPLLLAAKDNDVQALNKLLKYEDCKVHQRGAMGE
TALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARR
ASVSARATGTAFRRSPCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVL
HILILQPNKTFACQMYNLLLSYDRHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLM
QKRKHTQWTYGPLTSTLYDLTEIDSSGDEQSLLELIITTKKREARQILDQTPVKELVSLK
WKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTP
KDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTM
VMRLISASGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVV
ILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYA
AFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQIVATTVMLERKLPRCLWPRSGICG
REYGLGDRWFLRVEDRQDLNRQRIQRYAQAFHTRGSEDLDKDSVEKLELGCPFSPHLSLP
MPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQI
NT seq 2298 nt   +upstreamnt  +downstreamnt
acgggacctctacagggagacggtgggccggcccttgggggggctgatgtggccccaagg
ctgagtcccgtcagggtctggcctcggcctcaggcccccaaggagccggccctacacccc
atgggtttgtcactgcccaaggagaaagggctaattctctgcctatggagcaagttctgc
agatggttccagagacgggagtcctgggcccagagccgagatgagcagaacctgctgcag
cagaagaggatctgggagtctcctctccttctagctgccaaagataatgatgtccaggcc
ctgaacaagttgctcaagtatgaggattgcaaggtgcaccagagaggagccatgggggaa
acagcgctacacatagcagccctctatgacaacctggaggccgccatggtgctgatggag
gctgccccggagctggtctttgagcccatgacatctgagctctatgagggtcagactgca
ctgcacatcgctgttgtgaaccagaacatgaacctggtgcgagccctgcttgcccgcagg
gccagtgtctctgccagagccacaggcactgccttccgccgtagtccctgcaacctcatc
tactttggggagcaccctttgtcctttgctgcctgtgtgaacagtgaggagatcgtgcgg
ctgctcattgagcatggagctgacatccgggcccaggactccctgggaaacacagtgtta
cacatcctcatcctccagcccaacaaaacctttgcctgccagatgtacaacctgttgctg
tcctacgacagacatggggaccacctgcagcccctggacctcgtgcccaatcaccagggt
ctcacccctttcaagctggctggagtggagggtaacactgtgatgtttcagcacctgatg
cagaagcggaagcacacccagtggacgtatggaccactgacctcgactctctatgacctc
acagagatcgactcctcaggggatgagcagtccctgctggaacttatcatcaccaccaag
aagcgggaggctcgccagatcctggaccagacgccggtgaaggagctggtgagcctcaag
tggaagcggtacgggcggccgtacttctgcatgctgggtgccatatatctgctgtacatc
atctgcttcaccatgtgctgcatctaccgccccctcaagcccaggaccaataaccgcacg
agcccccgggacaacaccctcttacagcagaagctacttcaggaagcctacatgacccct
aaggacgatatccggctggtcggggagctggtgactgtcattggggctatcatcatcctg
ctggtagaggttccagacatcttcagaatgggggtcactcgcttctttggacagaccatc
cttgggggcccattccatgtcctcatcatcacctatgccttcatggtgctggtgaccatg
gtgatgcggctcatcagtgccagcggggaggtggtacccatgtcctttgcactcgtgctg
ggctggtgcaacgtcatgtacttcgcccgaggattccagatgctaggccccttcaccatc
atgattcagaagatgatttttggcgacctgatgcgattctgctggctgatggctgtggtc
atcctgggctttgcttcagccttctatatcatcttccagacagaggaccccgaggagcta
ggccacttctacgactaccccatggccctgttcagcaccttcgagctgttccttaccatc
atcgatggcccagccaactacaacgtggacctgcccttcatgtacagcatcacctatgct
gcctttgccatcatcgccacactgctcatgctcaacctcctcattgccatgatgggcgac
actcactggcgagtggcccatgagcgggatgagctgtggagggcccagattgtggccacc
acagtgatgctggagcggaagctgcctcgctgcctgtggcctcgctccgggatctgcgga
cgggagtatggcctgggagaccgctggttcctgcgggtggaagacaggcaagatctcaac
cggcagcggatccaacgctacgcacaggccttccacacccggggctctgaggatttggac
aaagactcagtggaaaaactagagctgggctgtcccttcagcccccacctgtcccttcct
atgccctcagtgtctcgaagtacctcccgcagcagtgccaattgggaaaggcttcggcaa
gggaccctgaggagagacctgcgtgggataatcaacaggggtctggaggacggggagagc
tgggaatatcagatctga

DBGET integrated database retrieval system