KEGG   Homo sapiens (human): 5554
Entry
5554              CDS       T01001                                 

Gene name
PRH1, Db-s, PA, PIF-S, PRH2, Pr1/Pr2
Definition
(RefSeq) proline rich protein HaeIII subfamily 1
  KO
K13910  salivary acidic proline-rich phosphoprotein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    5554 (PRH1)
SSDB
Motif
Pfam: Pro-rich
Other DBs
NCBI-GeneID: 5554
NCBI-ProteinID: NP_001278243
OMIM: 168730
HGNC: 9366
Ensembl: ENSG00000231887
Vega: OTTHUMG00000186774
Pharos: P02810(Tbio)
UniProt: P02810 A0A087WV42 F1T0A8
LinkDB
Position
12p13.2
AA seq 187 aa
MLLILLSVALLAFSSAQDLNEDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSA
GDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGG
HPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGP
PQGQSPQ
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcttctgattctgctgtcagtggccctgctggccttcagctcagctcaggatttaaat
gaagatgtcagccaggaagatgttcccctcgtaatatcagatggaggagactctgagcag
ttcctagatgaggagcgtcagggaccacctttgggaggacagcaatctcaaccctctgct
ggtgatgggaaccaggatgatggccctcagcagggaccaccccaacaaggaggccagcag
caacaaggtccaccacctcctcagggaaagccacaaggaccaccccaacaaggaggccag
cagcaacaaggtccaccacctcctcagggaaagccacaaggaccaccccaacagggaggc
catccccctcctcctcaaggaaggccacaaggaccaccccaacagggaggccatccccgt
cctcctcgaggaaggccacaaggaccaccccaacagggaggccatcagcaaggtcctccc
ccacctcctcctggaaagccccagggaccacctccccaagggggccgcccacaaggacct
ccacaggggcagtctcctcagtaa

KEGG   Homo sapiens (human): 5555
Entry
5555              CDS       T01001                                 

Gene name
PRH2, PRP-1/PRP-2, Pr, pr1/Pr2
Definition
(RefSeq) proline rich protein HaeIII subfamily 2
  KO
K13910  salivary acidic proline-rich phosphoprotein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    5555 (PRH2)
SSDB
Motif
Pfam: Pro-rich
Other DBs
NCBI-GeneID: 5555
NCBI-ProteinID: NP_001103683
OMIM: 168790
HGNC: 9367
Ensembl: ENSG00000134551
Vega: OTTHUMG00000168556
Pharos: P02810(Tbio)
UniProt: P02810
LinkDB
Position
12p13.2
AA seq 166 aa
MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSA
GDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRP
PRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcttctgattctgctgtcagtggccctgctggccttcagctcagctcaggacttagat
gaagatgtcagccaagaagacgttcccttggtaatatcagatggaggagactctgagcag
ttcatagatgaggagcgtcagggaccacctttgggaggacagcaatctcaaccctctgct
ggtgatgggaaccagaatgatggccctcagcagggaccaccccaacaaggaggccagcag
caacaaggtccaccacctcctcagggaaagccacaaggaccaccccaacagggaggccat
ccccctcctcctcaaggaaggccacaaggaccaccccaacagggaggccatccccgtcct
cctcgaggaaggccacaaggaccaccccaacagggaggccatcagcaaggtcctccccca
cctcctcctggaaagccccagggaccacctccccaagggggccgcccacaaggacctcca
caggggcagtctcctcagtaa

DBGET integrated database retrieval system