KEGG   Homo sapiens (human): 55556Help
Entry
55556             CDS       T01001                                 

Gene name
ENOSF1, FUCD, RTS, TYMSAS
Definition
(RefSeq) enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    55556 (ENOSF1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     55556 (ENOSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N DUF2247
Motif
Other DBs
NCBI-GeneID: 55556
NCBI-ProteinID: NP_059982
OMIM: 607427
HGNC: 30365
Ensembl: ENSG00000132199
Vega: OTTHUMG00000131470
Pharos: Q7L5Y1(Tbio)
UniProt: Q7L5Y1
LinkDB All DBs
Structure
PDB: 

Position
18p11.32
AA seq 443 aa AA seqDB search
MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGK
GTEVVVCAVNALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLN
AVWDLWAKQEGKPVWKLLVDMDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREK
QMLAQGYPAYTTSCAWLGYSDDTLKQLCAQALKDGWTRFKVKVGADLQDDMRRCQIIRDM
IGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVPLGIG
IATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVG
LCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE
ESVKKHQYPDGEVWKKLLPAQEN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcggcaggatctcccggctctcggtccgggacgtgcgcttccccacgtcgctt
gggggccacggcgcggacgccatgcacacggaccctgactactcggctgcctatgtcgtc
atagaaactgatgcagaagatggaatcaaggggtgtggaattaccttcactctgggaaaa
ggcactgaagttgttgtctgtgctgtgaatgccctcgcccaccatgtgctcaacaaggac
ctcaaggacattgttggtgacttcagaggcttctataggcagctcacaagtgatgggcag
ctcagatggattggtccagaaaagggcgtggtgcacctggcgacagcggccgtcctaaac
gcggtgtgggacttgtgggccaagcaggagggaaagcctgtctggaagttacttgtggac
atggatcccaggatgctggtatcctgcatagatttcaggtacatcactgatgtcctgact
gaggaggatgccctagaaatactgcagaaaggtcaaattggtaaaaaagaaagagagaag
caaatgctggcacaaggataccctgcttacacgacatcgtgcgcctggctggggtactca
gatgacacgttgaagcagctctgtgcccaggcgctgaaggatggctggaccaggtttaaa
gtaaaggtgggtgctgatctccaggatgacatgcgaagatgccaaatcatccgagacatg
attggaccggaaaagactttgatgatggatgccaaccagcgctgggatgtgcctgaggcg
gtggagtggatgtccaagctggccaagttcaagccattgtggattgaggagccaacctcc
cctgatgacattctggggcacgccaccatttccaaggcactggtcccattaggaattggc
attgccacaggagaacagtgccacaatagagtgatatttaagcaactcctacaggcgaag
gccctgcagttcctccagattgacagttgcagactgggcagtgtcaatgagaacctctca
gtattgctgatggccaaaaagtttgaaattcctgtttgcccccatgctggtggagttggc
ctctgtgaactggtgcagcacctgattatatttgactacatatcagtttctgcaagcctt
gaaaatagggtgtgtgagtatgttgaccacctgcatgagcatttcaagtatcccgtgatg
atccagcgggcttcctacatgcctcccaaggatcccggctactcaacagaaatgaaggag
gaatctgtaaagaaacaccagtatccagatggtgaagtttggaagaaactccttcctgct
caagaaaattaa

DBGET integrated database retrieval system