KEGG   Homo sapiens (human): 55567
Entry
55567             CDS       T01001                                 

Gene name
DNAH3, DNAHC3-B, DNAHC3B, HDHC8, HEL-36, HSADHC3
Definition
(RefSeq) dynein axonemal heavy chain 3
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55567 (DNAH3)
   05016 Huntington disease
    55567 (DNAH3)
   05022 Pathways of neurodegeneration - multiple diseases
    55567 (DNAH3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     55567 (DNAH3)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_lid_1 AAA_5 AAA Spc7 T2SSE ARL2_Bind_BART
Other DBs
NCBI-GeneID: 55567
NCBI-ProteinID: NP_060009
OMIM: 603334
HGNC: 2949
Ensembl: ENSG00000158486
Vega: OTTHUMG00000090677
Pharos: Q8TD57(Tdark)
UniProt: Q8TD57
LinkDB
Position
16p12.3
AA seq 4116 aa
MGATGRLELTLAAPPHPGPAFQRSKARETQGEEEGSEMQIAKSDSIHHMSHSQGQPELPP
LPASANEEPSGLYQTVMSHSFYPPLMQRTSWTLAAPFKEQHHHRGPSDSIANNYSLMAQD
LKLKDLLKVYQPATISVPRDRTGQGLPSSGNRSSSEPMRKKTKFSSRNKEDSTRIKLAFK
TSIFSPMKKEVKTSLTFPGSRPMSPEQQLDVMLQQEMEMESKEKKPSESDLERYYYYLTN
GIRKDMIAPEEGEVMVRISKLISNTLLTSPFLEPLMVVLVQEKENDYYCSLMKSIVDYIL
MDPMERKRLFIESIPRLFPQRVIRAPVPWHSVYRSAKKWNEEHLHTVNPMMLRLKELWFA
EFRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWI
HFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEM
KFFIPQLIMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTA
AAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQ
VGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVP
LAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTK
ELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQIEDIFDNSRNLLLHKRD
QAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFE
LINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIA
EEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQI
SEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTF
SFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNL
DAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQP
RMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLK
KCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMRE
VIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALAENTLLDFLKKSNDQIAQ
IVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDV
QVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTK
DLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILS
IQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYA
LIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKY
PEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKK
MKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFA
VEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIW
IENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGW
KPLKDSYMDTLPSSLTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRL
YSSLLDEIRAVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFR
NLIMGMDDNHPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEEEKVPAG
AKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLHLPKNTYLPNC
INFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELL
RQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDIL
TKIFSSIVDWHFGKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSR
VIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTI
EKVLIHLSPTGKIVDDNIRSLFFGDYFKPESDQKIYDEITDLKQLTVVMEHYLEEFNNIS
KAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEI
TKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPA
DEKADIVEKMQTAARTQGEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMF
PSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYY
NKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQREL
TALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDL
AEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSG
KMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSA
CEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALN
DDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVL
LSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLP
VDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQ
LGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPH
YLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIED
KILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVH
SATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNN
VCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAW
AEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPHEEQLPGSWKFSQGLEKMVILRCLR
PDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFAD
DLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIV
PESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQS
CAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEV
PFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIEEDYYSLAPGDTYYIPPHGSY
QSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVV
EELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRA
IKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGP
PVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPQETVMENNPEDGAYIKGL
FLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLS
TTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN
NT seq 12351 nt   +upstreamnt  +downstreamnt
atgggagctacagggcgcctcgagctcacactggccgcccctccccatccgggcccagcc
tttcagcgttcaaaagccagggagacccaaggagaggaggaagggagtgaaatgcagatc
gccaaaagtgactccatacatcacatgagccactcccaggggcagccagagctgcctcct
ctgcctgcttctgctaatgaggaaccgtctggactctatcagactgtcatgtcacacagc
ttttacccgcccttgatgcaacgcacgtcatggaccttggctgcacccttcaaagaacag
catcaccaccgtggacccagtgattccatcgccaacaactactccttgatggcccaggac
ctgaagctgaaagatctgctgaaggtctaccaaccggccaccatcagtgtccctagggac
aggaccggtcaggggctgccatcatcaggaaatagaagctcatcagagcccatgaggaaa
aaaacgaagttttcctccagaaacaaagaggattccactaggatcaagttggccttcaag
acgtcaatcttctcacccatgaagaaggaggtaaagacatctttgacgttcccaggaagc
agaccaatgagtccagaacagcagctcgatgtcatgttacagcaggagatggaaatggaa
agtaaagaaaagaagccatctgaatcggacctggagagatactattactatctgaccaat
ggaattcgcaaagacatgattgcccctgaggagggtgaagtgatggttcggatttcaaag
ctgatttctaacacgctgctgacgagtcccttcctggagcccctgatggtggtcctcgtg
caggagaaggagaatgactattactgtagcctcatgaaaagcatcgttgattacatcctc
atggacccaatggagagaaaacggctctttattgagagcatcccccgcttgtttcctcaa
agagtgatccgggcccctgtgccctggcacagtgtctacaggagcgccaagaagtggaac
gaggagcatctgcacacggtgaaccccatgatgctcaggctgaaagaactgtggtttgca
gaattcagagacctcaggtttgttcgaacagcagaaatactagcgggaaaattgcctctg
cagcctcaggaattttgggatgtgatccagaaacactgcctggaggcacaccagactctt
ctcaacaagtggatccccacctgcgcccagctttttacctcacggaaggagcactggatt
cattttgctcccaagagcaactatgactcaagtcgaaacattgaggaatattttgcttct
gtggcatcattcatgtcgctgcagcttagggagctggtcattaagtcacttgaggacctc
gtttcccttttcatgatacacaaagatgggaatgattttaaggagccctaccaagagatg
aagtttttcatacctcagctaatcatgatcaaacttgaagtcagtgaacccattattgtc
ttcaatccatcttttgatggctgctgggaattaatacgtgactctttcctggaaattatt
aagaactctaatgggatccccaagctgaaatacataccacttaagttctccttcactgct
gctgctgctgatcggcaatgtgtgaaagcagctgagccaggagagcccagcatgcacgcg
gctgccactgcaatggcagagctgaaaggatataatctgctccttggaactgttaacgca
gaagaaaaacttgtttctgattttttgattcaaactttcaaggtatttcagaaaaatcaa
gttggcccctgcaaatatttaaatgtctacaaaaagtatgttgacttattggataacacg
gcagagcaaaacatcgctgcgttcctgaaagaaaatcatgacattgatgattttgtgacg
aagatcaatgccataaagaaacggagaaatgaaattgcatccatgaacatcaccgtgcct
ttagccatgttctgccttgatgctacggccctaaatcatgatctctgtgagcgagctcaa
aatcttaaagaccatctgattcaattccaagtggatgtaaaccgagacaccaataccagc
atttgtaatcagtacagccacatcgcagacaaagtcagtgaggttcctgccaacactaag
gagctggtatccctcattgaattcctaaagaaatccagtgctgtcactgtgttcaaactc
aggaggcaacttagagatgcaagtgaacggctggagttcctgatggactatgcagacttg
ccgtaccagattgaagatatctttgacaacagccggaacttgctccttcacaagagggat
caggcagaaatggatctgattaaaagatgctcagaatttgagttgagacttgagggctac
cacagagaactggaaagttttaggaagcgcgaagtgatgactacagaagaaatgaagcac
aatgttgaaaagcttaatgagctttcaaagaacctaaatcgggcgtttgcagagtttgag
ttgatcaataaggaggaagagctattggaaaaggagaagagtacttaccctcttctgcag
gccatgctgaagaacaaagtaccttatgagcagctgtggtcgacagcctatgagttcagc
atcaagtcagaggaatggatgaatggacccctcttcttactgaatgctgagcaaattgcg
gaggagatagggaatatgtggaggacaacgtataaactgatcaagaccttgtctgatgtg
cctgcacccaggcgcttagcagagaatgtgaagatcaagatcgataagttcaagcagtac
attcccatcctcagtatttcctgcaacccaggaatgaaagaccgacactggcagcagatc
agtgagattgttggctatgagataaagcccaccgaaacgacctgcctctcaaatatgctc
gaatttggattcggcaaattcgttgaaaaattggagcccattggtgcagctgccagcaag
gaatactctctggagaaaaacttggatagaatgaagttggattgggttaacgtgacgttc
agcttcgtgaaatacagggacactgatacaaacatcttgtgtgcaattgatgacattcaa
atgctacttgatgatcacgtgataaagacccagaccatgtgtggctccccattcatcaaa
ccaatagaagcagaatgccggaaatgggaagaaaagctaattcgcatacaagacaatttg
gatgcctggttgaaatgccaagccacctggctgtacctggaaccaatcttcagttcagag
gacatcatagcccagatgccagaagaggggaggaaatttggcattgttgatagttactgg
aaatcacttatgtcccaagcggtgaaagataacaggattctggtggcagccgaccagcca
cggatggcagagaagcttcaagaagccaactttctcttggaggacatccagaaagggctg
aatgattacttggagaagaagagactattcttccccagattcttcttcctatcaaacgat
gagctgctggaaatcttgtccgagacaaaggaccctctccgagtgcagccgcacttgaag
aagtgctttgaaggaattgccaagcttgagtttacagacaatctggaaattgtgggcatg
atcagctcggaaaaagaaactgttccattcatacagaaaatctacccagctaatgccaag
ggcatggtggaaaagtggctccagcaggtggagcagatgatgctggccagtatgcgagaa
gtcattggacttgggattgaagcatatgtcaaggtccctcgaaatcactgggtcttacag
tggcctggacaggtggttatctgtgtctcctccatcttttggacccaggaggtgtcccaa
gccctggcggaaaataccttactggattttctgaaaaagagcaatgatcagattgcgcag
attgtccagctggtgcgagggaagctgagcagtggagctcgactcactctcggggccctc
acggtcatcgatgtccacgcccgcgacgtggtggccaagttatctgaggacagggtctcc
gatctgaatgatttccaatggatctcacagctgcgctactactgggtggccaaggatgtg
caggtgcagattatcaccacagaagccttgtatggctatgagtacctgggaaactccccc
cggctggtgatcacacccctcaccgaccgctgctacaggacactgatgggagctttgaag
ctgaaccttgggggtgctccagagggtccagctgggactggcaagacagaaaccaccaaa
gatttggccaaagccttggctaagcagtgtgtggtcttcaactgctccgatggtttggat
tacaaagctatggggaagttcttcaaggggctggcacaggctggagcatgggcgtgcttt
gatgagttcaacaggatcgaggtagaagtgctgtctgtggtcgctcagcagatcctcagc
atccaacaagccatcattcggaagctaaagacattcatctttgaagggactgagctctct
ctgaacccaacctgcgctgtgttcatcaccatgaaccccgggtatgctggcagggctgaa
ctgcccgacaatctcaaggccttgttccggacagtggccatgatggtcccagattacgcc
ctcattggagaaatctccctctactccatggggtttctggactccagaagtctcgcccag
aagatcgttgcgacctaccgcctgtgctcggaacaactgtcctctcagcatcactatgac
tacggtatgcgcgctgtcaagtctgtgcttactgccgcaggaaacctgaagctcaagtat
ccagaggagaatgaaagtgtcctgctgctccgggcattgcttgatgtcaatctggccaag
ttcttagcgcaagatgtccctctgtttcagggaattatatctgatttatttcctggagtt
gttcttccaaagccagactatgaagtttttctgaaagtgctgaatgataacatcaaaaag
atgaaactccagccagtaccttggtttatagggaaaattatccagatctacgaaatgatg
ctggtgagacatggctatatgattgtaggagaccccatgggcggcaagacctctgcttat
aaagtgttggctgcagctctcggcgatttacacgcagccaatcagatggaggagtttgct
gtggagtacaagatcatcaaccccaaggctatcacgatggggcagctgtatgggtgcttt
gaccaagtgagccacgagtggatggatggtgtccttgccaatgctttccgggagcaagcg
tcttcactctctgatgatcgcaagtggattatatttgatgggccagtggatgctatttgg
attgaaaatatgaacactgttctggatgacaataaaaagctgtgtctcatgagtggggaa
attatccagatgaactccaagatgagcctgatcttcgagcccgccgacctcgagcaagcc
tctccagccactgtgagcaggtgtgggatgatctacatggagccccatcaactaggctgg
aagcccctgaaggattcctacatggacaccctgccctccagtctcaccaaggagcacaaa
gaattggtcaatgacatgttcatgtggcttgtccagccctgcctggaatttggtcgcctt
cattgtaaatttgttgtccagacatctcccatccaccttgccttctcaatgatgagactg
tactcttctctgcttgatgaaatcagggcagtagaagaggaggaaatggaattaggtgaa
ggcctgtcaagtcaacagatctttctctggctccaaggactgtttctcttttccttggtg
tggaccgtggctggcaccatcaacgcagacagcagaaagaaatttgatgtgtttttccgc
aacctgatcatgggcatggatgataaccacccaaggcccaaaagcgtcaaactcaccaaa
aacaacatctttccagaaagaggaagcatctatgatttttattttatcaaacaagctagt
ggacattgggaaacgtggacacagtatatcaccaaagaggaggaaaaagttccagctggt
gcaaaggtctcagaactcatcatccccacaatggagacagcccggcagtccttcttcttg
aaaacctacttagaccatgagattccaatgctgttcgtgggtcccacaggcactggcaaa
tcagccatcaccaacaacttccttctccaccttcccaaaaatacgtacctacccaactgc
atcaatttctctgccagaacctcagccaatcagacccaggatatcatcatgtccaagctg
gatcgacgacggaagggccttttcgggcctcccatagggaagaaagcagtggtgtttgtg
gatgacctcaacatgccagccaaagaggtgtatggggcccagccacccatcgagctcctg
aggcagtggattgaccatggttactggtttgacaaaaaagacacaaccaggctggacatc
gtggacatgctgctcgtgacagccatggggccccccgggggaggaaggaatgacattact
ggacgattcactcgccatctgaatatcatttccatcaatgcctttgaggatgacatttta
accaagattttcagttcgattgttgactggcacttcgggaaagggtttgatgtgatgttt
ttaaggtacggaaagatgctggtccaagctactaagacaatttatagagatgcagtggag
aacttcttgccaactccctcgaagtcacattacgtctttaacctgcgggacttctcacga
gtgattcaaggggtcctgctgtgccctcacacacacctgcaggatgtagaaaaatgtatc
cggctttggatccatgaggtttatcgggtcttctatgatcgtctgattgacaaggaggac
agacaggtctttttcaacatggtgaaggaaaccacctccaattgcttcaagcagaccata
gagaaggtgcttatccacttgtcacccactggaaagatagtcgatgataacattcgaagc
ctcttctttggagattatttcaagccagaaagtgaccaaaaaatctacgatgagatcact
gacctgaaacagctgactgtggtcatggagcactatctggaagaattcaacaacatcagc
aaggcccccatgtccctggtcatgttcaggtttgccattgagcacatctctaggatctgc
cgtgtcctgaagcaggacaaaggccacctgctcctggtgggcatagggggcagcgggcgg
caaagtgccgccaaactgtccacattcatgaacgcatacgagctataccagattgagatc
accaagaactacgcaggcaatgactggcgagaagatcttaagaagatcatactgcaggtc
ggtgtggccaccaagagcaccgtgttcctcttcgccgacaaccagatcaaggatgaatca
ttcgtggaggacatcaacatgcttctgaacacaggtgacgtgcctaacatcttccctgct
gacgagaaggctgacatcgtggagaagatgcagactgcagccaggacccaaggagagaag
gttgaagtcactcctctttctatgtataacttctttattgagagggtaattaacaaaatc
tccttttcattagccatgagtccaataggggatgccttcaggaaccgcctgcggatgttc
ccttcgctgatcaattgctgtacgattgattggttccagtcctggcccacagatgcccta
gagttggtggctaacaaatttctagaggatgtggagcttgatgacaacattcgggtagag
gtcgtgtccatgtgcaaatatttccaagagagcgtcaagaagctgtcactcgattattac
aacaaacttcgaagacacaactatgttacccccacctcctaccttgaattgattctaacc
ttcaagacgctcctgaatagcaagaggcaagaggtggctatgatgaggaaccgctacctg
acaggcttgcagaaactcgactttgcagcttctcaggtagcggttatgcaaagagaactg
acagctcttcaacctcaactcatcctcacctccgaggaaactgccaagatgatggtgaaa
attgaagcggagacgagagaagctgatggaaagaaacttctggtgcaggcagatgaaaaa
gaagccaatgttgctgctgccattgcccaaggaatcaagaacgaatgtgagggggaccta
gctgaggcaatgcctgcactcgaggctgcactagctgctctggacaccctgaacccggcc
gacatctcgctggtgaagtcgatgcagaacccaccaggccctgtcaaactggtcatggag
agcatctgcatcatgaaagggatgaagccagagaggaagccagaccccagtggctccggt
aagatgatagaagattactggggggtatccaaaaagattcttggggatctgaaattcttg
gagagtcttaagacatatgacaaagacaacatccccccactgaccatgaagcggatccgg
gaaaggtttatcaatcacccggaattccagccagctgtcattaaaaatgtatcgtcggcc
tgcgagggtctgtgcaagtgggtgagggccatggaggtgtacgatcgcgtggccaaggtg
gtggctcccaaacgggagcgactgagggaggcagaggggaagctggctgcacagatgcag
aagctgaaccagaaaagagcagagctgaagctggtggtagatcggctccaggccctgaat
gacgactttgaagagatgaacaccaagaaaaaggacttggaggaaaacattgaaatctgc
tcccaaaagctggtcagggcagagaaactgatcagtggtcttgggggagagaaggacaga
tggaccgaagctgcccgacagctggggatccgctatactaatctgactggtgacgtgttg
ctgtcctcaggaactgtggcttacctgggcgcttttacagtggattatcgggtccagtgc
caaaatcagtggttggctgaatgtaaggacaaggtcatccctggcttcagtgacttcagt
ctcagccacacgttaggggatcccataaaaatccgtgcctggcagattgctgggcttccc
gttgactccttctccatcgacaatggcatcattgtatccaattccagacgctgggcctta
atgattgaccctcacgggcaggccaataaatggattaagaacatggagaaggcgaataaa
ctggctgtcatcaagttctctgatagcaactacatgaggatgctggaaaacgcgctgcag
ttaggcacccctgtcttgattgaaaacattggagaagagctggatgcttctatcgaacct
atcttgctcaaggcaacattcaaacagcaaggagttgagtacatgaggctgggtgaaaac
atcattgaatattccagggattttaagttatacatcacaacccgtttgaggaatccacat
tacctcccagaagttgccgtgaaggtctgtctcctcaacttcatgatcacccccttgggt
ctccaagatcaactccttggcatcgtggctgcgaaggagaagccagagctggaagagaaa
aagaaccagttgattgtggaaagtgccaagaacaagaagcatctcaaggaaattgaagat
aagatcttggaggttctctccatgtccaagggtaacatcctggaggatgaaaccgccatc
aaagttctgtcctcctccaaagtgctatctgaagagatctcagagaaacagaaagttgct
tccatgacagaaacgcagattgacgagactcggatgggctacaagccagtggctgtgcat
tctgccaccatcttcttttgtatctcggacctggccaacatcgagccgatgtaccagtac
tccctgacttggttcataaatctctacatgcattccttgacccacagcacgaagagcgag
gaactgaatctgcgcatcaagtacatcattgaccatttcaccctgagcatctacaacaac
gtgtgccgttctctgtttgagaaggacaagctactcttctctctcctcctgaccatcggc
atcatgaaacagaagaaggaaattacggaggaggtgtggtacttccttctcactggaggc
atcgcactggataacccctaccccaatccagctccccaatggctgtctgagaaggcatgg
gcagagattgtccgtgcatctgccttacccaaactgcatggcctgatggagcatttggaa
cagaacctgggtgaatggaagctgatctatgactcggcctggccccatgaggagcaactc
cctgggtcttggaagttctctcaaggattggagaagatggtgatccttcgatgtttgcgg
cctgacaaaatggtgccagcggtccgggagttcattgctgaacatatgggaaagctgtat
atcgaagcccctacgttcgatctccagggatcctacaatgattccagctgctgtgcgcct
ttgatttttgtgttgtctccaagtgcagacccaatggcaggcctgctgaagtttgctgat
gatcttggtatgggaggtaccagaacacagaccatctcccttggccaaggccaaggccct
attgctgccaaaatgatcaacaatgccatcaaagacgggacctgggtggtcttacagaac
tgccacctggccgcaagctggatgcctaccctggagaagatttgtgaggaggtgattgtt
cctgagagcaccaatgccagattcagactctggctaaccagctatccatcagagaagttt
ccagtcagcattctccagaatggaatcaaaatgaccaatgagccccccaaagggctccgg
gccaacctgttgcgctcctacctcaatgaccccatctcagatcctgtgttcttccaaagc
tgtgcaaaggcggtgatgtggcaaaagatgttatttggcctttgtttcttccacgccgtt
gttcaagagagaagaaacttcggccccctagggtggaatattccctatgaattcaacgaa
tctgacctgaggattagtatgtggcagatccagatgtttctcaatgactacaaggaggtg
ccctttgatgctctgacctacctgacaggggaatgtaattacggaggcagagtgactgat
gacaaagaccggcgtctcctgctgtcacttctgtccatgttctactgtaaggaaattgag
gaggactattactccctcgctcctggagacacttactacatccctcctcatggctcctac
cagtcctatatcgactatctcaggaatctccccatcacagcccacccagaagtgttcggc
ctccatgagaacgcagacatcaccaaagacaaccaggaaaccaaccagctgtttgagggg
gtcctgctgaccctccctagacagtcaggaggaagtggcaagtcccctcaggaagtggtt
gaggagttggcacaagacattctctccaagcttcccagagactttgacctggaagaggtc
atgaagttgtaccccgtggtctatgaagaatccatgaataccgtcctaaggcaggagctc
atcagattcaacaggctgaccaaagtggttcggaggagcctcatcaatcttggccgagcc
atcaaaggacaggtcctgatgtcctcggagctagaggaagtctttaacagcatgcttgtg
ggtaaagtgccagccatgtgggcagccaagtcttacccatcactgaagcctctggggggc
tacgtggctgacctgctggcccgcctgaccttcttccaggaatggattgacaaggggccc
cctgtggtattttggatctctggattctacttcacacagtcttttttgactggcgtctct
caaaattatgcccggaaatataccatccccattgaccacattggatttgagtttgaggta
accccacaagaaacagtgatggagaataaccccgaagatggggcctacatcaaagggctc
ttcttagaaggtgcccgttgggacaggaaaacgatgcagattggggaatctctccccaaa
atcctctatgacccactgcccatcatttggctgaaacctggggagagcgcaatgtttctg
catcaggacatctatgtgtgtccagtctacaaaacaagtgcccgcagaggaaccctctcc
accacaggccactctaccaactatgtcctctccattgagcttccaacagacatgccccag
aagcactggataaaccgaggggtggcctcactgtgccagctggataactga

DBGET integrated database retrieval system