KEGG   Homo sapiens (human): 55578
Entry
55578             CDS       T01001                                 

Gene name
SUPT20H, C13, C13orf19, FAM48A, FP757, P38IP, SPT20
Definition
(RefSeq) SPT20 homolog, SAGA complex component
  KO
K21245  transcription factor SPT20 homolog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55578 (SUPT20H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55578 (SUPT20H)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    SAGA complex
     55578 (SUPT20H)
SSDB
Motif
Pfam: Spt20
Other DBs
NCBI-GeneID: 55578
NCBI-ProteinID: NP_001014308
OMIM: 613417
HGNC: 20596
Ensembl: ENSG00000102710
Vega: OTTHUMG00000016747
Pharos: Q8NEM7(Tbio)
UniProt: Q8NEM7
LinkDB
Position
13q13.3
AA seq 779 aa
MQQALELALDRAEYVIESARQRPPKRKYLSSGRKSVFQKLYDLYIEECEKEPEVKKLRRN
VNLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEEL
PPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSI
TSDNHKWTQEDKLLLESQLILATAEPLCLDPSIAVTCTANRLLYNKQKMNTRPMKRCFKR
YSRSSLNRQQDLSHCPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCNL
AIPSEVDVEKYAKVEKSIKSDDSQPTVWPAHDVKDDYVFECEAGTQYQKTKLTILQSLGD
PLYYGKIQPCKADEESDSQMSPSHSSTDDHSNWFIIGSKTDAERVVNQYQELVQNEAKCP
VKMSHSSSGSASLSQVSPGKETDQTETVSVQSSVLGKGVKHRPPPIKLPSSSGNSSSGNY
FTPQQTSSFLKSPTPPPSSKPSSIPRKSSVDLNQVSMLSPAALSPASSSQRTTATQVMAN
SAGLNFINVVGSVCGAQALMSGSNPMLGCNTGAITPAGINLSGLLPSGGLLPNALPSAMQ
AASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQ
PGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRF
QLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgcaacaagctttagaactagctttggatcgtgcagagtatgtcattgaaagtgcccga
cagagacctcctaaaaggaaatacctatcaagtggaagaaaatctgtatttcaaaaactt
tatgacttgtatattgaagaatgtgaaaaagaacctgaagttaagaaattaagaagaaat
gtgaacttgttagagaagcttgttatgcaagagactttgtcatgtttagtggtcaatcta
tacccaggaaatgagggatattctctgatgctcaggggaaaaaacggatcagattccgag
accattcgactgccctatgaagaaggagagttgcttgaatatttggatgcagaagaatta
cctcctattttggttgatctcctagaaaaatctcaggttaatatttttcattgcggatgt
gtcatagcagaaatacgtgactacaggcagtccagtaacatgaaatctcctggttaccaa
agtcggcacattctcttacgtccaacaatgcagactttaatttgtgatgtacattcaata
acaagtgataaccacaaatggacccaggaagacaaacttttgcttgagagccagctcatc
ctagctacagctgaaccactctgtcttgatccttctatagcagtcacctgcactgcaaac
agactgctctataacaagcaaaagatgaacactcgcccaatgaaacggtgtttcaagagg
tattccagatcctctctgaatcggcagcaagatctatctcattgtccacctcctcctcag
ctgaggttacttgatttcttacaaaaaagaaaggaaagaaaagcaggtcagcattatgac
ctcaaaatttctaaggcaggaaattgtgtagatatgtggaaacggagtccctgtaatttg
gccataccttctgaagtagatgtggagaaatatgctaaagtggaaaagtctatcaaatct
gatgactcacagccaacagtctggccagcccatgatgtaaaagatgattatgtatttgaa
tgtgaagctggtactcagtatcagaaaacaaagctgaccatcttgcagtcgcttggagat
ccactttactatggtaaaatacagccatgtaaagcagatgaagaaagtgacagccagatg
tctccatcacactcgtccacagatgatcattcaaattggttcattattggatcaaagacc
gatgctgagagggtagtcaatcagtaccaagaattagtccagaatgaagccaaatgtccg
gtcaagatgtcacacagctccagtggctcagccagtctgagtcaggtttctccagggaaa
gaaacagatcaaactgaaaccgtgtcagttcagtcttcggtattggggaagggtgtaaaa
catcgacccccaccaatcaaacttccctcaagctcaggaaatagttcctcaggtaactat
tttacaccacaacagacaagcagctttctcaaatctccaactcctcctccttcttctaag
ccatcaagtattcctcggaaatcatctgtggatctcaatcaagttagcatgctttctcca
gctgccctatcacctgccagctcatcacaaagaaccacggccacccaggtcatggcaaac
tctgctggacttaacttcatcaatgtagtgggctctgtttgtggggcccaggctttgatg
agtggttcaaaccccatgctgggctgtaacactggtgccataactcctgcaggaataaac
ctgagcggccttctaccctcaggaggtctgctaccaaatgcactgcccagtgcaatgcag
gcagcttctcaagcaggtgttccatttggtttaaaaaatacttcaagtctcaggccctta
aatctactccagcttccaggtggttcacttatttttaacactctgcagcagcagcaacag
cagctctcccagtttacaccacaacaacctcagcagcccacaacttgtagtcctcaacag
ccaggggagcagggttctgagcaaggttcaaccagtcaagaacaggccttatctgctcag
caagctgctgttattaaccttactggagtaggaagttttatgcagtcacaggcagctgtg
ttgtctcagcttggctctgccgagaacagacctgagcaaagccttcctcagcagagattc
cagctctcctctgcctttcaacagcagcagcaacagatacaacagttgcgattcttgcag
catcaaatggctatggcagcagcagcagcacaaacagctcagctacatcatcatcggcat
acaggcagccagtcaaaaagtaaaatgaagagaggcacgccaaccactccaaaattttga

DBGET integrated database retrieval system