KEGG   Homo sapiens (human): 55593Help
Entry
55593             CDS       T01001                                 

Gene name
OTUD5, DUBA
Definition
(RefSeq) OTU deubiquitinase 5
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    55593 (OTUD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    55593 (OTUD5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55593 (OTUD5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     55593 (OTUD5)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C85
   55593 (OTUD5)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    55593 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTU Peptidase_C65
Motif
Other DBs
NCBI-GeneID: 55593
NCBI-ProteinID: NP_060072
OMIM: 300713
HGNC: 25402
Ensembl: ENSG00000068308
Vega: OTTHUMG00000024130
Pharos: Q96G74(Tbio)
UniProt: Q96G74 A0A024QZ09
LinkDB All DBs
Structure
PDB: 

Position
Xp11.23
AA seq 571 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFA
EQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ
VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGT
VLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDE
ILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgactatactccccaaaaagaagccgccgcctcccgacgccgaccccgccaacgagccg
ccgccgcccgggccgatgcccccggcgccgcggcgcggcggaggtgtgggcgtgggcggc
ggcggcacgggcgtgggcggcggcgatcgcgaccgtgactccggcgtcgtgggggcccgt
ccgcgagcttcgccaccgcctcaaggcccgctaccaggaccgccgggcgctcttcatcgc
tgggcgctggccgtgccgcctggtgcagtggcgggtccccggccacaacaggcttctcca
cctccttgcgggggcccaggtggtcccggcggcggtcccggcgacgcgctgggcgcagcg
gcggcgggtgtgggtgccgcgggcgtggtggtgggtgtgggtggtgccgtaggcgtgggc
ggctgctgctccgggcctgggcacagcaagcggcgacgtcaagctcccggggttggcgcg
gttggcgggggcagtcccgagcgtgaggaggtcggcgcaggctacaacagtgaggacgag
tatgaggcggctgcagcacgcatcgaggctatggaccctgccactgtcgagcagcaggag
cattggtttgaaaaggccctacgagacaagaagggcttcatcatcaagcagatgaaggag
gatggcgcctgtctcttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcattgcatggactatctgatgaagaatgccgactacttctccaac
tatgtcacagaggactttaccacctacattaacaggaagcggaaaaacaattgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccgtcctgtggaggtgtaccag
tacagcacaggtacttctgcagtggaacccatcaacacattccatgggatacatcaaaac
gaggacgaacccattcgtgttagctaccatcggaatatccactataattcagtggtgaat
cctaacaaggccaccattggtgtggggctgggcctgccatcattcaaaccagggtttgca
gagcagtctctgatgaagaatgccataaaaacatcggaggagtcatggattgaacagcag
atgctagaagacaagaaacgggccacagactgggaggccacaaatgaagccatcgaggag
caggtggctcgggaatcctacctgcagtggttgcgggatcaggagaaacaggctcgccag
gtccgaggccccagccagccccggaaagccagcgccacatgcagttcggccacagcagca
gcctccagtggcctggaggagtggactagccggtccccgcggcagcggagttcagcctcg
tcacctgagcaccctgagctgcatgctgaattgggcatgaagcccccttccccaggcact
gttttagctcttgccaaacctccttcgccctgtgcgccaggtacaagcagtcagttctcg
gcaggggccgaccgggcaacttccccccttgtgtccctctaccctgctttggagtgccgg
gccctcattcagcagatgtccccctctgcctttggtctgaatgactgggatgatgatgag
atcctagcttcggtgctggcagtgtcccaacaggaatacctagacagtatgaagaaaaac
aaagtgcacagagacccgcccccagacaagagttga

DBGET integrated database retrieval system