KEGG   Homo sapiens (human): 5564Help
Entry
5564              CDS       T01001                                 

Gene name
PRKAB1, AMPK, HAMPKb
Definition
(RefSeq) protein kinase AMP-activated non-catalytic subunit beta 1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04710  Circadian rhythm
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5564 (PRKAB1)
   04068 FoxO signaling pathway
    5564 (PRKAB1)
   04152 AMPK signaling pathway
    5564 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5564 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5564 (PRKAB1)
   04922 Glucagon signaling pathway
    5564 (PRKAB1)
   04920 Adipocytokine signaling pathway
    5564 (PRKAB1)
   04921 Oxytocin signaling pathway
    5564 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    5564 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    5564 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    5564 (PRKAB1)
   04714 Thermogenesis
    5564 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    5564 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5564 (PRKAB1)
   04931 Insulin resistance
    5564 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 5564
NCBI-ProteinID: NP_006244
OMIM: 602740
HGNC: 9378
Ensembl: ENSG00000111725
Vega: OTTHUMG00000168954
Pharos: Q9Y478(Tbio)
UniProt: Q9Y478 A0A024RBN1
LinkDB All DBs
Structure
PDB: 

Position
12q24.23
AA seq 270 aa AA seqDB search
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataccagcagtgagcgcgccgcgctggagcggcatggtggccataagacgccc
cggagggacagctcggggggcaccaaggacggggacaggcccaagatcctgatggacagc
cccgaagacgccgacctcttccactccgaggaaatcaaggcaccagagaaggaggaattc
ctggcctggcagcatgatctggaagtgaatgataaagctcccgcccaggctcggccaacg
gtgtttcgatggacggggggcggaaaggaagtttacttatctgggtccttcaacaactgg
agtaaacttcccctcaccagaagccacaataactttgtagccatcctggatctgccggaa
ggagagcatcagtacaagttctttgtggatggtcagtggacgcacgacccttccgagccc
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agttctcccccaggaccctaccatcaggagccctacgtctgcaaacccgaagagcgcttt
cgggcaccccctattctccccccacatctcctccaggtcatcctgaacaaggacacgggg
atttcctgtgatccagctttgcttcctgagcccaatcacgtcatgctgaaccacctatac
gcgctgtctatcaaggatggagtgatggtgctcagcgcaacccaccggtacaagaagaag
tacgtcaccaccttgttatacaagcccatatga

DBGET integrated database retrieval system