KEGG   Homo sapiens (human): 5566
Entry
5566              CDS       T01001                                 

Gene name
PRKACA, PKACA, PPNAD4
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson disease
hsa05020  Prion disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06318  CaSR-PTH signaling
nt06322  TRH-TSH-TH signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06326  AVP signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
N00915  AVP-V2R-PKA signaling pathway
N00916  Mutation-inactivated AVP to AVP-V2R-PKA signaling pathway
N00917  Mutation-activated AVPR2 to AVP-V2R-PKA signaling pathway
N00922  FSHR-GNAS-PKA signaling pathway
N00923  Mutation-inactivated FSHB to FSHR-GNAS-PKA signaling pathway
Disease
H01431  Cushing syndrome
H02049  Bilateral macronodular adrenal hyperplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5566 (PRKACA)
   04014 Ras signaling pathway
    5566 (PRKACA)
   04310 Wnt signaling pathway
    5566 (PRKACA)
   04340 Hedgehog signaling pathway
    5566 (PRKACA)
   04371 Apelin signaling pathway
    5566 (PRKACA)
   04020 Calcium signaling pathway
    5566 (PRKACA)
   04024 cAMP signaling pathway
    5566 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5566 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5566 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5566 (PRKACA)
   04540 Gap junction
    5566 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5566 (PRKACA)
   04062 Chemokine signaling pathway
    5566 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    5566 (PRKACA)
   04910 Insulin signaling pathway
    5566 (PRKACA)
   04922 Glucagon signaling pathway
    5566 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    5566 (PRKACA)
   04912 GnRH signaling pathway
    5566 (PRKACA)
   04913 Ovarian steroidogenesis
    5566 (PRKACA)
   04915 Estrogen signaling pathway
    5566 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    5566 (PRKACA)
   04921 Oxytocin signaling pathway
    5566 (PRKACA)
   04926 Relaxin signaling pathway
    5566 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    5566 (PRKACA)
   04918 Thyroid hormone synthesis
    5566 (PRKACA)
   04919 Thyroid hormone signaling pathway
    5566 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    5566 (PRKACA)
   04916 Melanogenesis
    5566 (PRKACA)
   04924 Renin secretion
    5566 (PRKACA)
   04925 Aldosterone synthesis and secretion
    5566 (PRKACA)
   04927 Cortisol synthesis and secretion
    5566 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5566 (PRKACA)
   04270 Vascular smooth muscle contraction
    5566 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    5566 (PRKACA)
   04971 Gastric acid secretion
    5566 (PRKACA)
   04976 Bile secretion
    5566 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5566 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5566 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    5566 (PRKACA)
   04727 GABAergic synapse
    5566 (PRKACA)
   04725 Cholinergic synapse
    5566 (PRKACA)
   04728 Dopaminergic synapse
    5566 (PRKACA)
   04726 Serotonergic synapse
    5566 (PRKACA)
   04720 Long-term potentiation
    5566 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    5566 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    5566 (PRKACA)
   04742 Taste transduction
    5566 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    5566 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    5566 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    5566 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5566 (PRKACA)
   04714 Thermogenesis
    5566 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5566 (PRKACA)
   05205 Proteoglycans in cancer
    5566 (PRKACA)
   05203 Viral carcinogenesis
    5566 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    5566 (PRKACA)
   05020 Prion disease
    5566 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    5566 (PRKACA)
   05031 Amphetamine addiction
    5566 (PRKACA)
   05032 Morphine addiction
    5566 (PRKACA)
   05034 Alcoholism
    5566 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    5566 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5566 (PRKACA)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    5566 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5566 (PRKACA)
   05163 Human cytomegalovirus infection
    5566 (PRKACA)
   05165 Human papillomavirus infection
    5566 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5566 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5566 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5566 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5566 (PRKACA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5566 (PRKACA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5566 (PRKACA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5566 (PRKACA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5566 (PRKACA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5566 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 5566
NCBI-ProteinID: NP_002721
OMIM: 601639
HGNC: 9380
Ensembl: ENSG00000072062
Vega: OTTHUMG00000182051
Pharos: P17612(Tchem)
UniProt: P17612 A0A024R7J0
LinkDB
Structure
PDB: 

Position
19p13.12
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaaactgaaacagatcgaacacaccctgaatgaaaagcgcatcctgcaagctgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggagtacgtgcccggcggggagatgttctcacacctacggcggatcggaaggttcagt
gagccccatgcccgtttctacgcggcccagatcgtcctgacctttgagtatctgcactcg
ctggatctcatctacagggacctgaagccggagaatctgctcattgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
ggcacccctgagtacctggcccctgagattatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctgggggttcttatctatgaaatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcgcttcccttcc
cacttcagctctgacttgaaggacctgctgcggaacctcctgcaggtagatctcaccaag
cgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Homo sapiens (human): 5567
Entry
5567              CDS       T01001                                 

Gene name
PRKACB, PKA_C-beta, PKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson disease
hsa05020  Prion disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06318  CaSR-PTH signaling
nt06322  TRH-TSH-TH signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06326  AVP signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
N00915  AVP-V2R-PKA signaling pathway
N00916  Mutation-inactivated AVP to AVP-V2R-PKA signaling pathway
N00917  Mutation-activated AVPR2 to AVP-V2R-PKA signaling pathway
N00922  FSHR-GNAS-PKA signaling pathway
N00923  Mutation-inactivated FSHB to FSHR-GNAS-PKA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5567 (PRKACB)
   04014 Ras signaling pathway
    5567 (PRKACB)
   04310 Wnt signaling pathway
    5567 (PRKACB)
   04340 Hedgehog signaling pathway
    5567 (PRKACB)
   04371 Apelin signaling pathway
    5567 (PRKACB)
   04020 Calcium signaling pathway
    5567 (PRKACB)
   04024 cAMP signaling pathway
    5567 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5567 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5567 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5567 (PRKACB)
   04540 Gap junction
    5567 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5567 (PRKACB)
   04062 Chemokine signaling pathway
    5567 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    5567 (PRKACB)
   04910 Insulin signaling pathway
    5567 (PRKACB)
   04922 Glucagon signaling pathway
    5567 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    5567 (PRKACB)
   04912 GnRH signaling pathway
    5567 (PRKACB)
   04913 Ovarian steroidogenesis
    5567 (PRKACB)
   04915 Estrogen signaling pathway
    5567 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    5567 (PRKACB)
   04921 Oxytocin signaling pathway
    5567 (PRKACB)
   04926 Relaxin signaling pathway
    5567 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    5567 (PRKACB)
   04918 Thyroid hormone synthesis
    5567 (PRKACB)
   04919 Thyroid hormone signaling pathway
    5567 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    5567 (PRKACB)
   04916 Melanogenesis
    5567 (PRKACB)
   04924 Renin secretion
    5567 (PRKACB)
   04925 Aldosterone synthesis and secretion
    5567 (PRKACB)
   04927 Cortisol synthesis and secretion
    5567 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5567 (PRKACB)
   04270 Vascular smooth muscle contraction
    5567 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    5567 (PRKACB)
   04971 Gastric acid secretion
    5567 (PRKACB)
   04976 Bile secretion
    5567 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5567 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5567 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    5567 (PRKACB)
   04727 GABAergic synapse
    5567 (PRKACB)
   04725 Cholinergic synapse
    5567 (PRKACB)
   04728 Dopaminergic synapse
    5567 (PRKACB)
   04726 Serotonergic synapse
    5567 (PRKACB)
   04720 Long-term potentiation
    5567 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    5567 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    5567 (PRKACB)
   04742 Taste transduction
    5567 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    5567 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    5567 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    5567 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5567 (PRKACB)
   04714 Thermogenesis
    5567 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5567 (PRKACB)
   05205 Proteoglycans in cancer
    5567 (PRKACB)
   05203 Viral carcinogenesis
    5567 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    5567 (PRKACB)
   05020 Prion disease
    5567 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    5567 (PRKACB)
   05031 Amphetamine addiction
    5567 (PRKACB)
   05032 Morphine addiction
    5567 (PRKACB)
   05034 Alcoholism
    5567 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    5567 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5567 (PRKACB)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    5567 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5567 (PRKACB)
   05163 Human cytomegalovirus infection
    5567 (PRKACB)
   05165 Human papillomavirus infection
    5567 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5567 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5567 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5567 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5567 (PRKACB)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5567 (PRKACB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5567 (PRKACB)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5567 (PRKACB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5567 (PRKACB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5567 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 5567
NCBI-ProteinID: NP_002722
OMIM: 176892
HGNC: 9381
Ensembl: ENSG00000142875
Vega: OTTHUMG00000009975
Pharos: P22694(Tchem)
UniProt: P22694 B2RB89
LinkDB
Position
1p31.1
AA seq 351 aa
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggggaacgcggcgaccgccaagaaaggcagcgaggtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttttgaaaaaatgggagaatccaactcagaataatgccgga
cttgaagattttgaaaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtaaaacacaaagccactgaacagtattatgccatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggcagtgaat
tttcctttccttgttcgactggagtatgcttttaaggataattctaatttatacatggtt
atggaatatgtccctgggggtgaaatgttttcacatctaagaagaattggaaggttcagt
gagccccatgcacggttctatgcagctcagatagtgctaacattcgagtacctccattca
ctagacctcatctacagagatctaaaacctgaaaatctcttaattgaccatcaaggctat
atccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggacattatgt
ggaactccagagtatttggctccagaaataattctcagcaagggctacaataaggcagtg
gattggtgggcattaggagtgctaatctatgaaatggcagctggctatcccccattcttt
gcagaccaaccaattcagatttatgaaaagattgtttctggaaaggtccgattcccatcc
cacttcagttcagatctcaaggaccttctacggaacctgctgcaggtggatttgaccaag
agatttggaaatctaaagaatggtgtcagtgatataaaaactcacaagtggtttgccacg
acagattggattgctatttaccagaggaaggttgaagctccattcataccaaagtttaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtgcaaaagaatttggtgaattttaa

KEGG   Homo sapiens (human): 5568
Entry
5568              CDS       T01001                                 

Gene name
PRKACG, BDPLT19, KAPG, PKACg
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04976  Bile secretion
hsa05012  Parkinson disease
hsa05020  Prion disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05110  Vibrio cholerae infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05414  Dilated cardiomyopathy
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06318  CaSR-PTH signaling
nt06322  TRH-TSH-TH signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06326  AVP signaling
nt06360  Cushing syndrome
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00885  LHCGR-GNAS-PKA signaling pathway
N00886  Mutation-activated LHCGR to LHCGR-GNAS-PKA signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
N00915  AVP-V2R-PKA signaling pathway
N00916  Mutation-inactivated AVP to AVP-V2R-PKA signaling pathway
N00917  Mutation-activated AVPR2 to AVP-V2R-PKA signaling pathway
N00922  FSHR-GNAS-PKA signaling pathway
N00923  Mutation-inactivated FSHB to FSHR-GNAS-PKA signaling pathway
Disease
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5568 (PRKACG)
   04014 Ras signaling pathway
    5568 (PRKACG)
   04310 Wnt signaling pathway
    5568 (PRKACG)
   04340 Hedgehog signaling pathway
    5568 (PRKACG)
   04371 Apelin signaling pathway
    5568 (PRKACG)
   04020 Calcium signaling pathway
    5568 (PRKACG)
   04024 cAMP signaling pathway
    5568 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5568 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5568 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5568 (PRKACG)
   04540 Gap junction
    5568 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5568 (PRKACG)
   04062 Chemokine signaling pathway
    5568 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    5568 (PRKACG)
   04910 Insulin signaling pathway
    5568 (PRKACG)
   04922 Glucagon signaling pathway
    5568 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    5568 (PRKACG)
   04912 GnRH signaling pathway
    5568 (PRKACG)
   04913 Ovarian steroidogenesis
    5568 (PRKACG)
   04915 Estrogen signaling pathway
    5568 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    5568 (PRKACG)
   04921 Oxytocin signaling pathway
    5568 (PRKACG)
   04926 Relaxin signaling pathway
    5568 (PRKACG)
   04935 Growth hormone synthesis, secretion and action
    5568 (PRKACG)
   04918 Thyroid hormone synthesis
    5568 (PRKACG)
   04919 Thyroid hormone signaling pathway
    5568 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    5568 (PRKACG)
   04916 Melanogenesis
    5568 (PRKACG)
   04924 Renin secretion
    5568 (PRKACG)
   04925 Aldosterone synthesis and secretion
    5568 (PRKACG)
   04927 Cortisol synthesis and secretion
    5568 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5568 (PRKACG)
   04270 Vascular smooth muscle contraction
    5568 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    5568 (PRKACG)
   04971 Gastric acid secretion
    5568 (PRKACG)
   04976 Bile secretion
    5568 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    5568 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5568 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    5568 (PRKACG)
   04727 GABAergic synapse
    5568 (PRKACG)
   04725 Cholinergic synapse
    5568 (PRKACG)
   04728 Dopaminergic synapse
    5568 (PRKACG)
   04726 Serotonergic synapse
    5568 (PRKACG)
   04720 Long-term potentiation
    5568 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    5568 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    5568 (PRKACG)
   04742 Taste transduction
    5568 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    5568 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    5568 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    5568 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5568 (PRKACG)
   04714 Thermogenesis
    5568 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5568 (PRKACG)
   05205 Proteoglycans in cancer
    5568 (PRKACG)
   05203 Viral carcinogenesis
    5568 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    5568 (PRKACG)
   05020 Prion disease
    5568 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    5568 (PRKACG)
   05031 Amphetamine addiction
    5568 (PRKACG)
   05032 Morphine addiction
    5568 (PRKACG)
   05034 Alcoholism
    5568 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    5568 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    5568 (PRKACG)
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    5568 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5568 (PRKACG)
   05163 Human cytomegalovirus infection
    5568 (PRKACG)
   05165 Human papillomavirus infection
    5568 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5568 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5568 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5568 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5568 (PRKACG)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5568 (PRKACG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5568 (PRKACG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5568 (PRKACG)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5568 (PRKACG)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5568 (PRKACG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo RIO1
Other DBs
NCBI-GeneID: 5568
NCBI-ProteinID: NP_002723
OMIM: 176893
HGNC: 9382
Ensembl: ENSG00000165059
Vega: OTTHUMG00000019974
Pharos: P22612(Tbio)
UniProt: P22612
LinkDB
Position
9q21.11
AA seq 351 aa
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccaggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcacatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccgtccagtacctacactcg
ctcgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttcccacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaagcatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

KEGG   Homo sapiens (human): 5573
Entry
5573              CDS       T01001                                 

Gene name
PRKAR1A, ACRDYS1, ADOHR, CAR, CNC, CNC1, PKR1, PPNAD1, PRKAR1, TSE1
Definition
(RefSeq) protein kinase cAMP-dependent type I regulatory subunit alpha
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Disease
H00260  Pigmented micronodular adrenocortical disease
H01102  Pituitary adenomas
H01431  Cushing syndrome
H01820  Carney complex
H02211  Acrodysostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5573 (PRKAR1A)
SSDB
Motif
Pfam: cNMP_binding RIIa
Other DBs
NCBI-GeneID: 5573
NCBI-ProteinID: NP_001263218
OMIM: 188830
HGNC: 9388
Ensembl: ENSG00000108946
Vega: OTTHUMG00000180128
Pharos: P10644(Tbio)
UniProt: P10644 B2R5T5
LinkDB
Structure
PDB: 
5KJZ 5KJX 5KJY

Position
17q24.2
AA seq 381 aa
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSA
AVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSDILKRNIQQYNSFVSLSV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggagtctggcagtaccgccgccagtgaggaggcacgcagccttcgagaatgtgagctc
tacgtccagaagcataacattcaagcgctgctcaaagattctattgtgcagttgtgcact
gctcgacctgagagacccatggcattcctcagggaatactttgagaggttggagaaggag
gaggcaaaacagattcagaatctgcagaaagcaggcactcgtacagactcaagggaggat
gagatttctcctcctccacccaacccagtggttaaaggtaggaggcgacgaggtgctatc
agcgctgaggtctacacggaggaagatgcggcatcctatgttagaaaggttataccaaaa
gattacaagacaatggccgctttagccaaagccattgaaaagaatgtgctgttttcacat
cttgatgataatgagagaagtgatatttttgatgccatgttttcggtctcctttatcgca
ggagagactgtgattcagcaaggtgatgaaggggataacttctatgtgattgatcaagga
gagacggatgtctatgttaacaatgaatgggcaaccagtgttggggaaggagggagcttt
ggagaacttgctttgatttatggaacaccgagagcagccactgtcaaagcaaagacaaat
gtgaaattgtggggcatcgaccgagacagctatagaagaatcctcatgggaagcacactg
agaaagcggaagatgtatgaggaattccttagtaaagtctctattttagagtctctggac
aagtgggaacgtcttacggtagctgatgcattggaaccagtgcagtttgaagatgggcag
aagattgtggtgcagggagaaccaggggatgagttcttcattattttagaggggtcagct
gctgtgctacaacgtcggtcagaaaatgaagagtttgttgaagtgggaagattggggcct
tctgattattttggtgaaattgcactactgatgaatcgtcctcgtgctgccacagttgtt
gctcgtggccccttgaagtgcgttaagctggaccgacctagatttgaacgtgttcttggc
ccatgctcagacatcctcaaacgaaacatccagcagtacaacagttttgtgtcactgtct
gtctga

KEGG   Homo sapiens (human): 5575
Entry
5575              CDS       T01001                                 

Gene name
PRKAR1B, PRKAR1
Definition
(RefSeq) protein kinase cAMP-dependent type I regulatory subunit beta
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5575 (PRKAR1B)
SSDB
Motif
Pfam: cNMP_binding RIIa
Other DBs
NCBI-GeneID: 5575
NCBI-ProteinID: NP_001158230
OMIM: 176911
HGNC: 9390
Ensembl: ENSG00000188191
Vega: OTTHUMG00000151411
Pharos: P31321(Tbio)
UniProt: P31321
LinkDB
Structure
PDB: 
4F9K 4DIN

Position
7p22.3
AA seq 381 aa
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcctccccgcccgcctgcccctcggaggaggacgagagcctgaagggctgtgagctg
tacgtgcagctgcacgggatccagcaggtcctcaaagactgtatcgtccacctctgcatc
tccaagcccgaacgccccatgaagttcctccgggagcacttcgagaagctggagaaggaa
gaaaacaggcagattttggcgcggcaaaagtcaaactcacagtcggactcccatgatgag
gaggtgtcgcccacccccccgaaccctgtggtgaaggcccgccgccggcgaggaggcgtg
agtgccgaggtgtacaccgaggaggacgccgtgtcctacgtcaggaaggtgattcccaag
gactacaaaaccatgactgcgctggccaaggccatctccaagaacgtgctcttcgctcac
ctggatgacaacgagaggagtgacatattcgatgccatgttccctgtcactcacatcgct
ggggagactgttatacagcaagggaatgaaggagacaacttctatgtcgttgatcaaggg
gaagtggatgtgtacgtgaacggagagtgggtgaccaacatcagcgagggaggcagcttc
ggggagctggcgctcatctacggcacccccagggctgcgaccgtgaaagccaagacggac
ctcaagctctgggggatcgaccgggacagctaccggcgcatccttatgggcagcacgctg
aggaaacgcaagatgtacgaggagttcctcagcaaggtctccatcctagagtccctggag
aagtgggagcgtctgaccgtggcggatgcgctggagcccgtccagtttgaagatggagag
aaaattgtggtccagggagagcctggggacgacttttacatcatcacggagggcaccgcg
tccgtgctgcagcgccggtcccccaatgaggagtacgtggaggtggggcgcctgggaccc
tctgactacttcggggagattgcactgctgctgaaccggccccgggcggccactgtcgtg
gcccgggggcccctcaagtgtgtgaagctggaccggccccgcttcgagcgtgtgctgggg
ccctgctctgagatcctcaagaggaacattcagcgttacaacagcttcatctccctcacc
gtctga

KEGG   Homo sapiens (human): 5576
Entry
5576              CDS       T01001                                 

Gene name
PRKAR2A, PKR2, PRKAR2
Definition
(RefSeq) protein kinase cAMP-dependent type II regulatory subunit alpha
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5576 (PRKAR2A)
SSDB
Motif
Pfam: cNMP_binding RIIa
Other DBs
NCBI-GeneID: 5576
NCBI-ProteinID: NP_001308911
OMIM: 176910
HGNC: 9391
Ensembl: ENSG00000114302
Vega: OTTHUMG00000133540
Pharos: P13861(Tbio)
UniProt: P13861 A0A024R2W3 A8KAH7
LinkDB
Structure
PDB: 
4ZP3 2KYG 2IZX

Position
3p21.31
AA seq 404 aa
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCL
VMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgagccacatccagatcccgccggggctcacggagctgctgcagggctacacggtggag
gtgctgcgacagcagccgcctgacctcgtcgaattcgcagtggagtacttcacccgcctg
cgcgaggcccgcgccccagcctcagtcctgcccgccgccaccccacgccagagcctgggc
caccccccgccagaacccggcccggaccgtgtcgccgacgccaaaggggacagcgagtcg
gaggaggacgaggacttggaagttccagttcctagcagatttaatagacgagtatcagtc
tgtgctgagacctataaccctgatgaggaagaggaagatacagatccaagggtgattcat
cctaaaactgatgaacagagatgcagacttcaggaagcttgcaaagatattctccttttc
aaaaatcttgatcaggaacagctttctcaagttctcgatgccatgtttgaaaggatagtc
aaagctgatgagcatgtcattgaccaaggagatgatggagacaacttttatgtcatagaa
cggggaacttatgacattttagtaacaaaagataatcaaacccgctctgttggtcaatat
gacaaccgtggcagttttggagaactagctctgatgtacaacaccccgagagctgctacc
attgttgctacctcagaaggctccctttggggactggaccgggtgacttttagaagaatc
atagtgaaaaataatgcaaagaagaggaagatgtttgaatcatttattgagtctgtgccc
ctccttaaatcactagaggtgtcagaacgaatgaagattgtggatgtaataggagagaag
atctataaggatggagaacgcataatcactcagggtgaaaaggctgatagcttttacatc
atagagtctggcgaagtgagcatcttgattagaagcaggactaaatcaaacaaggatggt
gggaaccaggaggtcgagattgcccgctgccataaggggcagtactttggagagcttgcc
ctggtcaccaacaaacccagagctgcctcagcttatgcagttggagatgtcaaatgctta
gttatggatgtacaagcattcgagaggcttctggggccctgcatggacatcatgaagagg
aacatctcacactatgaggaacagctggtgaagatgtttggctccagcgtggatctgggc
aacctcgggcagtag

KEGG   Homo sapiens (human): 5577
Entry
5577              CDS       T01001                                 

Gene name
PRKAR2B, PRKAR2, RII-BETA
Definition
(RefSeq) protein kinase cAMP-dependent type II regulatory subunit beta
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5577 (PRKAR2B)
SSDB
Motif
Pfam: cNMP_binding RIIa
Other DBs
NCBI-GeneID: 5577
NCBI-ProteinID: NP_002727
OMIM: 176912
HGNC: 9392
Ensembl: ENSG00000005249
Vega: OTTHUMG00000137418
Pharos: P31323(Tbio)
UniProt: P31323 B3KY43 A0A024R712
LinkDB
Position
7q22.3
AA seq 418 aa
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagcatcgagatcccggcgggactgacggagctgctgcagggcttcacggtggaggtg
ctgaggcaccagcccgcggacctgctggagttcgcgctgcagcacttcacccgcctgcag
caggagaacgagcgcaaaggcaccgcgcgcttcggccatgagggcaggacctggggggac
ctgggcgccgctgccgggggcggcacccccagcaagggggtcaacttcgccgaggagccc
atgcagtccgactccgaggacggggaggaggaggaggcggcgcccgcggacgcaggggcg
ttcaatgctccagtaataaaccgattcacaaggcgtgcctcagtatgtgcagaagcttat
aatcctgatgaagaagaagatgatgcagagtccaggattatacatccaaaaactgatgat
caaagaaataggttgcaagaggcttgcaaagacatcctgctgtttaagaatctggatccg
gagcagatgtctcaagtattagatgccatgtttgaaaaattggtcaaagatggggagcat
gtaattgatcaaggtgacgatggtgacaacttttatgtaattgatagaggcacatttgat
atttatgtgaaatgtgatggtgttggaagatgtgttggtaactatgataatcgtgggagt
ttcggcgaactggccttaatgtacaatacacccagagcagctacaatcactgctacctct
cctggtgctctgtggggtttggacagggtaaccttcaggagaataattgtgaaaaacaat
gccaaaaagagaaaaatgtatgaaagctttattgagtcactgccattccttaaatctttg
gagttttctgaacgcctgaaagtagtagatgtgataggcaccaaagtatacaacgatgga
gaacaaatcattgctcagggagattcggctgattcttttttcattgtagaatctggagaa
gtgaaaattactatgaaaagaaagggtaaatcagaagtggaagagaatggtgcagtagaa
atcgctcgatgctcgcggggacagtactttggagagcttgccctggtaactaacaaacct
cgagcagcttctgcccacgccattgggactgtcaaatgtttagcaatggatgtgcaagca
tttgaaaggcttctgggaccttgcatggaaattatgaaaaggaacatcgctacctatgaa
gaacagttagttgccctgtttggaacgaacatggatattgttgaacccactgcatga

DBGET integrated database retrieval system