KEGG   Homo sapiens (human): 55670
Entry
55670             CDS       T01001                                 

Gene name
PEX26, PBD7A, PBD7B, PEX26M1T, Pex26pM1T
Definition
(RefSeq) peroxisomal biogenesis factor 26
  KO
K13340  peroxin-26
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00177  Neonatal adrenoleukodystrophy
H00204  Infantile Refsum disease
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    55670 (PEX26)
SSDB
Motif
Pfam: Pex26
Other DBs
NCBI-GeneID: 55670
NCBI-ProteinID: NP_001121121
OMIM: 608666
HGNC: 22965
Ensembl: ENSG00000215193
Vega: OTTHUMG00000149970
Pharos: Q7Z412(Tbio)
UniProt: Q7Z412 A0A024R100
LinkDB
Position
22q11.21
AA seq 305 aa
MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCER
AWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKV
LELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEEL
VVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLW
DSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQ
LRIRD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagagcgattcttcgacctctgcagcccccctcagggggctcgggggacccctgcgc
agcagcgagccggtgcgcgcggtcccggcccgggcgccggccgtggaccttctggaggag
gcggccgacctcctggtggtgcacctggacttccgggcggcgctggagacctgcgagcgg
gcctggcagagtctggccaaccacgccgtggcagaggaacccgcgggcacctcattggag
gtgaagtgctccctgtgtgttgtggggatccaggccctggcagaaatggatcggtggcaa
gaagtcctctcctgggtccttcagtattaccaggtccctgaaaagctaccccccaaagtc
ctggagctgtgcattcttttatacagcaaaatgcaagagcctggagctgtgctggatgtg
gtgggtgcctggctccaagacccagccaatcaaaaccttccagaatatggagccttggca
gaatttcacgtgcagcgggtgctgctgcctctgggctgcttatcggaggctgaggagcta
gtggtgggctctgcagcctttggtgaggagcggcgactggatgtacttcaggccattcac
acagcgaggcagcagcagaaacaggaacactcaggctctgaggaggcccagaagccaaac
ctggaaggctctgtctcccacaagttcctgtcactaccgatgttggttcgccagctttgg
gactctgcggtgagccacttcttttctctgcccttcaaaaagagtctcctggctgccttg
atcctctgtctcctggtggtgagatttgatccagcttccccttcctccctgcacttcctc
tacaagctggcccagctcttccgctggatccggaaggctgcattttctcgcctctaccag
ctccgcatccgtgactga

DBGET integrated database retrieval system