KEGG   Homo sapiens (human): 55697Help
Entry
55697             CDS       T01001                                 

Gene name
VAC14, ArPIKfyve, TAX1BP2, TRX
Definition
(RefSeq) VAC14 component of PIKFYVE complex
  KO
K15305  vacuole morphology and inheritance protein 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    55697 (VAC14)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    55697 (VAC14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vac14_Fig4_bd Vac14_Fab1_bd HEAT HEAT_EZ TAF6_C
Motif
Other DBs
NCBI-GeneID: 55697
NCBI-ProteinID: NP_060522
OMIM: 604632
HGNC: 25507
Ensembl: ENSG00000103043
Vega: OTTHUMG00000137583
Pharos: Q08AM6(Tbio)
UniProt: Q08AM6
LinkDB All DBs
Position
16q22.1-q22.2
AA seq 782 aa AA seqDB search
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVSFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDELDELRPGQRQAEPTPDDALPKQ
EGTASGGPDGSCDSSFSSGISVFTAASTERAPVTLHLDGIVQVLNCHLSDTAIGMMTRIA
VLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTDDP
GPLDGPDLQASHSELQVPTPGRAGLLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFSS
ERKLLEVRGPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHALNTILLTSTELF
QLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVD
FLAEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCV
PNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRV
VL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgagaaggatttcgcgccgctcacgcctaacatcgtgcgcgccctcaatgac
aagctgtacgaaaagcggaaggtggcagcgctggagatcgagaagctggtccgggagttc
gtggcccagaacaataccgtgcaaatcaagcatgtgatccagaccctgtcccaggagttt
gccctgtctcagcacccccacagccggaaagggggcctcatcggcctggccgcctgctcc
atcgcactgggcaaggactcagggctctacctgaaggagctgatcgagccagtgctgacc
tgcttcaatgatgcagacagcaggctgcgctactatgcctgcgaggccctctacaacatc
gtcaaggtggcccggggcgctgtgctgccccacttcaacgtgctctttgacgggctgagc
aagctggcagccgacccagaccccaatgtgaaaagcggatctgagctcctagaccgcctt
ttaaaggacattgtgactgagagcaacaagtttgacctggtgagcttcatccccttgttg
cgagagaggatttactccaacaaccagtatgcccggcagttcatcatctcctggatcctg
gttctggagtcggtgccagacattaacctgctggattacctgccggagatcctggatgga
ctcttccagatcctgggtgacaatggcaaagagattcgcaaaatgtgtgaggttgttctt
ggagaattcttaaaagaaattaagaagaacccctccagtgtgaagtttgctgagatggcc
aacatcctggtgatccactgccagacaacagatgacctcatccagctgacagccatgtgc
tggatgcgggagttcatccagctggcgggccgcgtcatgctgccttactcctccgggatc
ctgactgctgtcttgccctgcttggcctacgatgaccgcaagaaaagcatcaaagaagtg
gccaacgtgtgcaaccagagcctgatgaagctggtcacccccgaggacgacgagctggat
gagctgagacctgggcagaggcaggcagagcccacccctgacgatgccctgccaaagcag
gagggcacagccagtggaggtccagatggttcctgtgactccagcttcagtagcggcatc
agtgtcttcactgcagccagcactgaaagagccccagtgacccttcacctcgacgggatc
gtgcaggtcctaaactgccacctcagtgacacggccattgggatgatgaccaggattgca
gttctcaagtggctctaccacctctacatcaaaactcctcggaagatgttccggcacacg
gacagcctctttcccatcctactgcagacgttatcggatgaatcggatgaggtgatcctg
aaggacctggaggtgctggcagaaatcgcttcctcccccgcaggccagacggatgaccca
ggccccctcgatggccctgacctccaggccagccactcagagctccaggtgcccacccct
ggcagagccggcctactgaacacctctggtaccaaaggcttagaatgttctccttcaact
cccaccatgaattcttacttttataagttcatgatcaaccttctcaagagattcagcagc
gaacggaagctcctggaggtcagaggccctttcatcatcaggcagctgtgcctcctgctg
aatgcggagaacatcttccactcaatggcagacatcctgctgcgggaggaggacctcaag
ttcgcctcgaccatggtccacgccctcaacaccatcctgctgacctccacagagctcttc
cagctaaggaaccagctgaaggacctgaagaccctggagagccagaacctgttctgctgc
ctgtaccgctcctggtgccacaacccagtcaccacggtgtccctctgcttcctcacccag
aactaccggcacgcctatgacctcatccagaagtttggggacctggaggtcaccgtggac
ttcctcgcagaggtggacaagctggtgcagctgattgagtgccccatcttcacatatctg
cgcctgcagctgctggacgtgaagaacaacccctacctgatcaaggccctctacggcctg
ctcatgctcctgccgcagagcagcgccttccagctgctctcgcaccggctccagtgcgtg
cccaaccctgagctgctgcagaccgaagacagtctaaaggcagcccccaagtcccagaaa
gctgactcccctagcatcgactacgcagagctgctgcagcactttgagaaggtccagaac
aagcacctggaagtgcggcaccagcggagcgggcgtggggaccacctggaccggagggtt
gtcctctga

DBGET integrated database retrieval system