KEGG   Homo sapiens (human): 55711
Entry
55711             CDS       T01001                                 

Gene name
FAR2, HEL-S-81, MLSTD1, SDR10E2
Definition
(RefSeq) fatty acyl-CoA reductase 2
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    55711 (FAR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    55711 (FAR2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     55711 (FAR2)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 3Beta_HSD Semialdhyde_dh GDP_Man_Dehyd KR
Other DBs
NCBI-GeneID: 55711
NCBI-ProteinID: NP_001258712
OMIM: 616156
HGNC: 25531
Ensembl: ENSG00000064763
Vega: OTTHUMG00000169320
Pharos: Q96K12(Tbio)
UniProt: Q96K12 A0A024RAW7 Q9NUX8 B2RBI0
LinkDB
Position
12p11.22
AA seq 515 aa
MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQIL
DSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDT
LRHAVQLNVTATRQLLLMASQMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDS
LEWLDDAIIDEITPKLIRDWPNIYTYTKALGEMVVQQESRNLNIAIIRPSIVGATWQEPF
PGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDTVVNLMLAVGWYTAVHRPKST
LVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQYWNAVSHRAP
AIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV
FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWR
LLIARSQMARNVWFFIVSFCYKFLSYFRASSTLKV
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgtccacaattgcagctttctatggcggcaagtccattctcatcacgggggccacaggc
tttctgggcaaagtgctgatggagaagctgtttcgcaccagcccagacctgaaagtcatt
tacatccttgtgaggcccaaggctggccagacactgcagcagagggttttccagatccta
gacagtaagctatttgagaaagtcaaagaagtttgtccaaatgtgcatgagaagatcaga
gctatttatgcagatctcaatcagaatgactttgccatcagcaaagaggacatgcaggag
cttctctcctgtacaaacataatatttcactgtgcagccactgtacgctttgacgacact
ctcagacatgctgtgcaacttaacgtcactgccacccggcagctcttgcttatggctagt
cagatgccaaagctggaagcctttatacatatctctactgcctattcaaattgtaacctg
aagcacatcgatgaagttatctatccgtgccctgtggagccaaaaaaaatcattgattcc
cttgagtggttagacgatgctattattgacgagattacacccaagctgatcagagattgg
cccaatatttatacctacaccaaggccttgggagaaatggtggtgcagcaagagagcagg
aacctgaacattgccatcataaggccctccattgtgggagcaacttggcaggagcctttc
ccaggttgggttgataatataaatggacctaatggaatcattattgcgactgggaaaggg
tttcttcgggccataaaagctactccaatggctgtggcagacgtaattccagttgataca
gtcgtcaatctcatgctagctgtaggatggtatactgcagttcacagacctaagtcaaca
ttagtctaccacattacatctggtaacatgaatccctgcaattggcacaaaatgggagtc
caagtcttggcaacctttgaaaaaatcccatttgagagacctttcaggaggccaaatgct
aattttaccagcaacagcttcacatcacagtactggaatgcggtcagccaccgggcccct
gccattatctatgactgctatctgcggctcactggaaggaagcccaggatgacaaagctc
atgaatcggcttttaagaactgtttccatgttggagtatttcatcaaccggagttgggaa
tggagcacgtacaatacagaaatgctgatgtctgagctgagtcctgaagaccagagagta
ttcaactttgacgtgcgccagttgaactggttggaatacattgaaaattatgttttggga
gttaaaaaatacttattgaaagaggatatggctgggatcccaaaagcaaagcaacgctta
aaaaggctccgaaatattcactacctctttaatactgccctcttccttatcgcctggcgc
cttctcattgcaagatctcagatggctcggaatgtctggttcttcattgtaagcttctgt
tataaattcctctcctactttagagcatccagcacgctcaaagtttaa

KEGG   Homo sapiens (human): 84188
Entry
84188             CDS       T01001                                 

Gene name
FAR1, MLSTD2, PFCRD, SDR10E1
Definition
(RefSeq) fatty acyl-CoA reductase 1
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00207  Rhizomelic chondrodysplasia punctata
H02100  Peroxisomal fatty acyl-CoA reductase 1 disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    84188 (FAR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    84188 (FAR1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     84188 (FAR1)
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 Semialdhyde_dh 3Beta_HSD GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 84188
NCBI-ProteinID: NP_115604
OMIM: 616107
HGNC: 26222
Ensembl: ENSG00000197601
Vega: OTTHUMG00000165743
Pharos: Q8WVX9(Tbio)
UniProt: Q8WVX9
LinkDB
Position
11p15.3
AA seq 515 aa
MVSIPEYYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVL
SGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNEN
LRDAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDS
LEWMDDGLVNDITPKLIGDRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPF
PGWIDNFNGPSGLFIAAGKGILRTIRASNNALADLVPVDVVVNMSLAAAWYSGVNRPRNI
MVYNCTTGSTNPFHWGEVEYHVISTFKRNPLEQAFRRPNVNLTSNHLLYHYWIAVSHKAP
AFLYDIYLRMTGRSPRMMKTITRLHKAMVFLEYFTSNSWVWNTENVNMLMNQLNPEDKKT
FNIDVRQLHWAEYIENYCLGTKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVILIWR
IFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggtttcaatcccagaatactatgaaggcaagaacgtcctcctcacaggagctaccggt
tttctagggaaggtgcttctggaaaagttgctgaggtcttgtcctaaggtgaattcagta
tatgttttggtgaggcagaaagctggacagacaccacaagagcgagtggaagaagtcctt
agtggcaagctttttgacagattgagagatgaaaatccagattttagagagaaaattata
gcaatcaacagcgaactcacccaacctaaactggctctcagtgaagaagataaagaggtg
atcatagattctaccaatattatattccactgtgcagctacagtaaggtttaatgaaaat
ttaagagatgctgttcagttaaatgtgattgcaacgcgacagcttattctccttgcacaa
caaatgaagaatctggaagtgttcatgcatgtatcaacagcatatgcctactgtaatcgc
aagcatattgatgaagtagtctatccaccacctgtggatcccaagaagctgattgattct
ttagagtggatggatgatggcctagtaaatgatatcacgccaaaattgataggagacaga
cctaatacatacatatacacaaaagcattggcagaatatgttgtacaacaagaaggagca
aaactaaatgtggcaattgtaaggccatcgattgttggtgccagttggaaagaacctttt
ccaggatggattgataactttaatggaccaagtggtctctttattgcggcagggaaagga
attcttcgaacaatacgtgcctccaacaatgcccttgcagatcttgttcctgtagatgta
gttgtcaacatgagtcttgcggcagcctggtattccggagttaatagaccaagaaacatc
atggtgtataattgtacaacaggcagcactaatcctttccactggggtgaagttgagtac
catgtaatttccactttcaagaggaatcctctcgaacaggccttcagacggcccaatgta
aatctaacctccaatcatcttttatatcattactggattgctgtaagccataaggcccca
gcattcctgtatgatatctacctcaggatgactggaagaagcccaaggatgatgaaaaca
ataactcgtcttcacaaagctatggtgtttcttgaatatttcacaagtaattcttgggtt
tggaatactgagaatgtcaatatgttaatgaatcaactaaaccctgaagataaaaagacc
ttcaatattgatgtacggcagttacattgggcagaatatatagagaactactgcttggga
actaagaagtacgtattgaatgaagaaatgtctggcctccctgcagccagaaaacatctg
aacaagttgcggaatatacgttatggttttaatactatccttgtgatcctcatctggcgc
atttttattgcaagatcacaaatggcaagaaatatctggtactttgtggttagtctgtgt
tacaagtttttgtcatacttccgagcatccagcactatgagatactga

DBGET integrated database retrieval system