KEGG   Homo sapiens (human): 558
Entry
558               CDS       T01001                                 

Gene name
AXL, ARK, JTK11, Tyro7, UFO
Definition
(RefSeq) AXL receptor tyrosine kinase
  KO
K05115  AXL receptor tyrosine kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
Drug target
Amuvatinib (DG01916): D09864 D09865
Bemcentinib: D11438
Cabozantinib (DG01670): D10062 D10095<JP/US>
Dubermatinib (DG03093): D11732 D11733
Merestinib: D11763
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    558 (AXL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    558 (AXL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     558 (AXL)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   558 (AXL)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase fn3 Ig_3 Ig_2 I-set ig V-set C2-set_2 Pkinase_fungal APH C1-set DUF2627 DUF4381
Other DBs
NCBI-GeneID: 558
NCBI-ProteinID: NP_068713
OMIM: 109135
HGNC: 905
Ensembl: ENSG00000167601
Vega: OTTHUMG00000182727
Pharos: P30530(Tchem)
UniProt: P30530
LinkDB
Structure
PDB: 
5VXZ 5U6B 4RA0 2C5D

Position
19q13.2
AA seq 894 aa
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVF
LGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETR
YGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGK
TLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGM
EYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIES
LADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYA
LMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggcgtggcggtgccccaggatgggcagggtcccgctggcctggtgcttggcgctgtgc
ggctgggcgtgcatggcccccaggggcacgcaggctgaagaaagtcccttcgtgggcaac
ccagggaatatcacaggtgcccggggactcacgggcacccttcggtgtcagctccaggtt
cagggagagccccccgaggtacattggcttcgggatggacagatcctggagctcgcggac
agcacccagacccaggtgcccctgggtgaggatgaacaggatgactggatagtggtcagc
cagctcagaatcacctccctgcagctttccgacacgggacagtaccagtgtttggtgttt
ctgggacatcagaccttcgtgtcccagcctggctatgttgggctggagggcttgccttac
ttcctggaggagcccgaagacaggactgtggccgccaacacccccttcaacctgagctgc
caagctcagggacccccagagcccgtggacctactctggctccaggatgctgtccccctg
gccacggctccaggtcacggcccccagcgcagcctgcatgttccagggctgaacaagaca
tcctctttctcctgcgaagcccataacgccaagggggtcaccacatcccgcacagccacc
atcacagtgctcccccagcagccccgtaacctccacctggtctcccgccaacccacggag
ctggaggtggcttggactccaggcctgagcggcatctaccccctgacccactgcaccctg
caggctgtgctgtcagacgatgggatgggcatccaggcgggagaaccagaccccccagag
gagcccctcacctcgcaagcatccgtgcccccccatcagcttcggctaggcagcctccat
cctcacaccccttatcacatccgcgtggcatgcaccagcagccagggcccctcatcctgg
acccactggcttcctgtggagacgccggagggagtgcccctgggcccccctgagaacatt
agtgctacgcggaatgggagccaggccttcgtgcattggcaagagccccgggcgcccctg
cagggtaccctgttagggtaccggctggcgtatcaaggccaggacaccccagaggtgcta
atggacatagggctaaggcaagaggtgaccctggagctgcagggggacgggtctgtgtcc
aatctgacagtgtgtgtggcagcctacactgctgctggggatggaccctggagcctccca
gtacccctggaggcctggcgcccagggcaagcacagccagtccaccagctggtgaaggaa
ccttcaactcctgccttctcgtggccctggtggtatgtactgctaggagcagtcgtggcc
gctgcctgtgtcctcatcttggctctcttccttgtccaccggcgaaagaaggagacccgt
tatggagaagtgtttgaaccaacagtggaaagaggtgaactggtagtcaggtaccgcgtg
cgcaagtcctacagtcgtcggaccactgaagctaccttgaacagcctgggcatcagtgaa
gagctgaaggagaagctgcgggatgtgatggtggaccggcacaaggtggccctggggaag
actctgggagagggagagtttggagctgtgatggaaggccagctcaaccaggacgactcc
atcctcaaggtggctgtgaagacgatgaagattgccatctgcacgaggtcagagctggag
gatttcctgagtgaagcggtctgcatgaaggaatttgaccatcccaacgtcatgaggctc
atcggtgtctgtttccagggttctgaacgagagagcttcccagcacctgtggtcatctta
cctttcatgaaacatggagacctacacagcttcctcctctattcccggctcggggaccag
ccagtgtacctgcccactcagatgctagtgaagttcatggcagacatcgccagtggcatg
gagtatctgagtaccaagagattcatacaccgggacctggcggccaggaactgcatgctg
aatgagaacatgtccgtgtgtgtggcggacttcgggctctccaagaagatctacaatggg
gactactaccgccagggacgtatcgccaagatgccagtcaagtggattgccattgagagt
ctagctgaccgtgtctacaccagcaagagcgatgtgtggtccttcggggtgacaatgtgg
gagattgccacaagaggccaaaccccatatccgggcgtggagaacagcgagatttatgac
tatctgcgccagggaaatcgcctgaagcagcctgcggactgtctggatggactgtatgcc
ttgatgtcgcggtgctgggagctaaatccccaggaccggccaagttttacagagctgcgg
gaagatttggagaacacactgaaggccttgcctcctgcccaggagcctgacgaaatcctc
tatgtcaacatggatgagggtggaggttatcctgaaccccctggagctgcaggaggagct
gaccccccaacccagccagaccctaaggattcctgtagctgcctcactgcggctgaggtc
catcctgctggacgctatgtcctctgcccttccacaacccctagccccgctcagcctgct
gataggggctccccagcagccccagggcaggaggatggtgcctga

DBGET integrated database retrieval system