KEGG   Homo sapiens (human): 55811Help
Entry
55811             CDS       T01001                                 

Gene name
ADCY10, HCA2, HEL-S-7a, SAC, SACI, Sacy, hsAC
Definition
(RefSeq) adenylate cyclase 10
  KO
K11265  adenylate cyclase 10 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
Drug target
Colforsin (DG02877): D01697 D03584
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    55811 (ADCY10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    55811 (ADCY10)
   04024 cAMP signaling pathway
    55811 (ADCY10)
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    55811 (ADCY10)
   04714 Thermogenesis
    55811 (ADCY10)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     55811 (ADCY10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AAA_22 AAA_16 DUF577 TPR_1
Motif
Other DBs
NCBI-GeneID: 55811
NCBI-ProteinID: NP_060887
OMIM: 605205
HGNC: 21285
Ensembl: ENSG00000143199
Vega: OTTHUMG00000034573
Pharos: Q96PN6(Tchem)
UniProt: Q96PN6 A0A0K0K1J8
LinkDB All DBs
Structure
PDB: 

Position
1q24.2
AA seq 1610 aa AA seqDB search
MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSS
AMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVI
KCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQN
MAQMNDVILSPNCWQLCDRSMIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYY
PSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLM
FEDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELT
HALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTVRHEYTVIGQKVNLAARMMMY
YPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVMFGMACLICNR
KEDYPLLGRNKEINYFMYTMKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRI
IAISLNKISFHQTFYTIQMFMANVLGLDTCKHYKERQTNLRNKVMTLLDEKFYCLLNDIF
HVQFPISREISRMSTLKKQKQLEILFMKILKLIVKEERIIFIIDEAQFVDSTSWRFMEKL
IRTLPIFIIMSLCPFVNIPCAAARAVIKNRNTTYIVIGAVQPNDISNKICLDLNVSCISK
ELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEKLN
MVTLHSDKESEEVCHLTSGVRLKNLSPPTSLKEISLIQLDSMRLSHQMLVRCAAIIGLTF
TTELLFEILPCWNMKMMIKTLATLVESNIFYCFRNGKELQKALKQNDPSFEVHYRSLSLK
PSEGMDHGEEEQLRELENEVIECHRIRFCNPMMQKTAYELWLKDQRKAMHLKCARFLEED
AHRCDHCRGRDFIPYHHFTVNIRLNALDMDAIKKMAMSHGFKTEEKLILSNSEIPETSAF
FPENRSPEEIREKILNFFDHVLTKMKTSDEDIIPLESCQCEEILEIVILPLAHHFLALGE
NDKALYYFLEIASAYLIFCDNYMAYMYLNEGQKLLKTLKKDKSWSQTFESATFYSLKGEV
CFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHFHYVNRQAQESPPPGKK
RLAQLYRQTVCLSLLWRIYSYSYLFHCKYYAHLAVMMQMNTALETQNCFQIIKAYLDYSL
YHHLAGYKGVWFKYEVMAMEHIFNLPLKGEGIEIVAYVAETLVFNKLIMGHLDLAIELGS
RALQMWALLQNPNRHYQSLCRLSRCLLLNSRYPQLIQVLGRLWELSVTQEHIFSKAFFYF
VCLDILLYSGFVYRTFEECLEFIHQYENNRILKFHSGLLLGLYSSVAIWYARLQEWDNFY
KFSNRAKNLLPRRTMTLTYYDGISRYMEGQVLHLQKQIKEQSENAQASGEELLKNLENLV
AQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESW
YSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFLMRANTVDNHF
NT seq 4833 nt NT seq  +upstreamnt  +downstreamnt
atgaacactccaaaagaagaattccaggactggcccatagtcagaatagcagctcattta
ccagacctcattgtctatggacatttctccccagagcgaccctttatggattattttgac
ggagtcctgatgtttgttgatatttcaggttttactgcaatgactgagaagttcagcagt
gccatgtacatggacagaggggctgagcagttggtggagatcctcaactaccacataagt
gcaatagtggagaaagtgttgatttttggaggagacatcctgaaatttgcaggtgatgca
ctgctagccctgtggagggtggagcgaaagcagctgaaaaacattatcacagtggtaatt
aaatgtagcctggagatccatggattgtttgagacccaggagtgggaagaaggcctagac
atccgagtcaagataggactggctgctggccacatcagcatgttggtctttggagatgaa
acacacagccactttctggtgattggtcaggcagtggacgatgtgcgccttgcccagaac
atggctcagatgaatgatgttattctgtcaccaaactgctggcagctctgtgaccggagc
atgattgaaattgagagtgttccagatcagagagcagttaaggttaacttcttaaaacca
ccccccaattttaattttgatgaatttttcacaaagtgtacgaccttcatgcattattat
ccttctggtgagcacaaaaacctcctgaggcttgcatgcacgctgaagcctgatcctgaa
ctggagatgtccctacaaaagtatgtgatggaaagcattttgaagcagattgataacaaa
cagcttcagggctatttatctgagcttcgcccagtgacgattgtgtttgtgaacctgatg
tttgaagaccaagacaaagcagaagagataggcccagccatccaggatgcctatatgcac
atcacttctgtcctgaagatcttccaaggccaaatcaataaagtcttcatgtttgacaag
ggctgctctttcctctgtgtctttggcttccctggggaaaaggtacctgacgagctcact
catgctctggaatgtgctatggatatatttgacttctgctctcaagtccacaaaatccaa
actgtatccatcggtgttgccagtgggattgtcttctgtgggatcgttggacacactgtg
agacacgagtacacagtcattggtcaaaaagtcaacttagctgccaggatgatgatgtac
tacccaggaattgtgacctgcgactctgtcacctacaatgggagcaacctaccagcgtac
ttttttaaagagcttccaaagaaagttatgaaaggtgttgcagattctggaccattgtat
cagtattggggccgtactgagaaagtcatgtttggtatggcgtgcctcatctgcaacaga
aaggaggattaccctttgctgggacgtaataaagagatcaactacttcatgtatactatg
aagaaatttttgatatctaacagcagccaagtcttaatgtatgagggattaccaggatat
ggaaaaagccagatacttatgaaaattgagtacctggcccaaggtaagaatcacaggatt
attgccatttcattgaataagatcagcttccatcaaactttctataccatccagatgttc
atggccaatgtcctaggcctagacacttgtaaacattataaagaacgacagaccaacctt
cgaaataaagtcatgacactgttggatgaaaagttctactgtcttcttaatgacattttc
catgttcagttccctatttctcgggagatttccaggatgagcaccttgaaaaagcaaaaa
caattggaaatattgtttatgaagatcttgaagctgatagtgaaagaggaaaggattatt
tttatcattgatgaggcccagtttgtggattcgacctcctggagatttatggagaagctt
atccggactcttcctatcttcatcattatgtccctgtgtcccttcgttaacattccctgt
gcagctgccagggccgtaataaagaacaggaacaccacctacattgtcattggtgcagta
cagcctaacgacatctccaacaagatctgtcttgacctcaatgtgagctgcatctccaaa
gaactggactcgtacctgggggagggaagctgtgggattccattttactgtgaagaattg
cttaaaaacctggaacatcatgaggtactcgttttccaacaaacggagtctgaggaaaag
acaaataggacctggaataacctgttcaagtattccattaagctaacagagaagttaaac
atggttactctccatagtgataaggaaagtgaagaagtctgtcacctcacaagtggtgtc
agactgaaaaacctgtcacctccaacgtcattaaaagaaatctctctgatccagctggat
agcatgagactttcccaccaaatgctggtgagatgtgctgccatcattggcctgaccttc
accactgagttgttgtttgagattctcccctgttggaatatgaagatgatgatcaagacc
ctggcaaccctagtggaatctaacattttttattgtttccggaatggcaaggagcttcaa
aaggccctgaaacagaatgatccctcatttgaggtgcactatcgttccttgtctctgaag
cccagtgaagggatggatcacggtgaagaggaacagcttcgtgaactggagaatgaggtg
atcgagtgccacaggattcgattctgtaaccctatgatgcagaaaacagcctacgagctg
tggctcaaggaccagagaaaagccatgcacttgaaatgtgcccgctttttagaagaagat
gcccacagatgtgaccactgccgaggcagggacttcattccctatcatcacttcacagtg
aatattcggctcaacgctttagacatggatgccattaaaaagatggctatgtctcatgga
tttaaaactgaagaaaagcttatcttgtccaactcagagattcctgagacatctgcattt
tttcctgaaaatcgcagtcctgaagaaataagagaaaagatcttgaatttctttgaccac
gttttaacaaaaatgaagacatctgacgaagacattatccctctggaatcttgccagtgt
gaagaaatcctagagattgtcatcttgcctctggcccaccattttctggctttgggagaa
aatgacaaagccttatattacttcttagaaattgcatctgcttatctcatcttttgtgat
aactacatggcatacatgtatttgaatgaaggacagaagttgctaaaaactctcaagaag
gacaaatcttggagccagacatttgagtctgccaccttttacagcctcaaaggtgaggtc
tgtttcaatatgggccagatagtgcttgccaagaaaatgctgaggaaggcactgaagctc
ctcaaccgaatctttccttacaacttaatctccttgtttctccatatccatgtcgagaaa
aacagacactttcattatgtgaatcggcaggcccaagagagcccacctccagggaagaag
aggctggcacaactttaccggcaaactgtctgcctttccttgctgtggcgcatctatagc
tacagttatctttttcactgcaagtattatgcccacctggcagttatgatgcaaatgaat
actgcactggaaactcaaaattgtttccagatcattaaggcttacctagactattcgcta
taccaccacctggctggctacaaaggtgtgtggttcaaatatgaagtcatggccatggag
cacatcttcaacctccccctgaaaggcgagggcattgaaatcgtggcatacgtggctgag
acactggtcttcaacaagctcataatgggacacctggatttggccattgagttaggctcc
cgagcccttcagatgtgggcactgctccagaatcccaaccgacattatcagtccctctgc
agacttagcagatgtctccttctgaacagcagatacccgcaattgatccaggtgctgggg
cggctgtgggagctttctgtaacacaggaacacatcttcagcaaggcatttttctatttt
gtctgcttggacatcctgctttattctggttttgtttatagaacatttgaagaatgtttg
gaattcatacaccaatacgaaaacaacagaatcctcaagttccacagtggactcctcctg
ggactttattcctctgtagctatctggtatgccagacttcaggaatgggacaacttttac
aaattttccaatagagctaaaaatcttttgccaagaagaaccatgacacttacttactat
gacggaatatctaggtacatggaggggcaagttcttcaccttcaaaaacaaatcaaagaa
cagtcagagaatgcccaagccagtggggaggagctactcaagaacttggagaatctggtg
gctcaaaataccactggccctgtcttttgcccaaggctctaccacctgatggcttacgtc
tgtatattaatgggagatgggcagaaatgtggcctcttcctgaacacagccttgcggctc
tctgaaacacaggggaatatactggagaaatgctggctgaacatgaacaaagaatcatgg
tactcaacctctgagttaaaagaagaccaatggcttcagacgatcttgagtctcccatca
tgggaaaaaattgtagcaggcagggtaaacattcaggatcttcaaaaaaacaaattcctg
atgagagctaataccgtggacaatcatttctaa

DBGET integrated database retrieval system