KEGG   Homo sapiens (human): 55825
Entry
55825             CDS       T01001                                 

Gene name
PECR, DCRRP, HPDHASE, HSA250303, PVIARL, SDR29C1, TERP
Definition
(RefSeq) peroxisomal trans-2-enoyl-CoA reductase
  KO
K07753  peroxisomal trans-2-enoyl-CoA reductase [EC:1.3.1.38]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    55825 (PECR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    55825 (PECR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     55825 (PECR)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   55825 (PECR)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP F420_oxidored Epimerase Polysacc_synt_2 GDP_Man_Dehyd 2-Hacid_dh_C 3Beta_HSD Shikimate_DH NAD_binding_10 Spore_IV_A Cloacin
Other DBs
NCBI-GeneID: 55825
NCBI-ProteinID: NP_060911
OMIM: 605843
HGNC: 18281
Ensembl: ENSG00000115425
Vega: OTTHUMG00000154825
Pharos: Q9BY49(Tbio)
UniProt: Q9BY49
LinkDB
Structure
PDB: 
1YXM

Position
2q35
AA seq 303 aa
MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAAD
ELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHIS
SKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYN
LTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVS
SVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEK
AKL
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcctcctgggctaagggcaggagctacctggcgcctggtttgctgcagggccaagtg
gccatcgtcaccggcggggccacgggcatcggaaaagccatcgtgaaggagctcctggag
ctggggagtaatgtggtcattgcatcccgtaagttggagagattgaagtctgcggcagat
gaactgcaggccaacctacctcccacaaagcaggcacgagtcattcccatacaatgcaac
atccggaatgaggaggaggtgaataatttggtcaaatctaccttagatacttttggtaag
atcaatttcttggtgaacaatggaggaggccagtttctttcccctgctgaacacatcagt
tctaagggatggcacgctgtgcttgagaccaacctgacgggtaccttctacatgtgcaaa
gcagtttacagctcctggatgaaagagcatggaggatctatcgtcaatatcattgtccct
actaaagctggatttccattagctgtgcattctggagctgcaagagcaggtgtttacaac
ctcaccaaatctttagctttggaatgggcctgcagtggaatacggatcaattgtgttgcc
cctggagttatttattcccagactgctgtggagaactatggttcctggggacaaagcttc
tttgaagggtcttttcagaaaatccccgctaaacgaattggtgttcctgaggaggtctcc
tctgtggtctgcttcctactgtctcctgcagcttccttcatcactggacagtcggtggat
gtggatgggggccggagtctctatactcactcgtatgaggtaccagatcatgacaactgg
cccaagggagcaggggacctttctgttgtcaaaaagatgaaggagacctttaaggagaaa
gctaagctctga

DBGET integrated database retrieval system