KEGG   Homo sapiens (human): 5585Help
Entry
5585              CDS       T01001                                 

Gene name
PKN1, DBK, PAK-1, PAK1, PKN, PKN-ALPHA, PRK1, PRKCL1
Definition
(RefSeq) protein kinase N1
  KO
K06071  serine/threonine-protein kinase N1 [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00866  Yersinia YopM to Pyrin Inflammasome signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    5585 (PKN1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    5585 (PKN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5585 (PKN1)
   05135 Yersinia infection
    5585 (PKN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5585 (PKN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5585 (PKN1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKN family
   5585 (PKN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase HR1 Pkinase_Tyr Pkinase_C Kinase-like PL48 Uds1 Haspin_kinase C2
Motif
Other DBs
NCBI-GeneID: 5585
NCBI-ProteinID: NP_002732
OMIM: 601032
HGNC: 9405
Ensembl: ENSG00000123143
Vega: OTTHUMG00000039611
Pharos: Q16512(Tchem)
UniProt: Q16512
LinkDB All DBs
Structure
PDB: 

Position
19p13.12
AA seq 942 aa AA seqDB search
MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLR
RATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTC
SATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQAGQLENQAAPDDTQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLS
AAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAF
STRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGGPGTPDSRPPF
LSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT
LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPV
IERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGS
EARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPA
LCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESL
MCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFY
SACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPE
FLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSA
EAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTD
VSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacgccgtgcagagtgagcctcgcagctggtccctgctagagcagctgggc
ctggccggggcagacctggcggcccccggggtacagcagcagctggagctggagcgggag
cggctgcggcgggaaatccgcaaggagctgaagctgaaggagggtgctgagaacctgcgg
cgggccaccactgacctgggccgcagcctgggccccgtagagctgctgctgcggggctcc
tcgcgccgcctcgacctgctgcaccagcagctgcaggagctgcacgcccacgtggtgctt
cccgacccggcggccacccacgatggcccccagtcccctggtgcgggtggccccacctgc
tcggccaccaacctgagccgcgtggcgggcctggagaagcagttggccattgagctgaag
gtgaagcagggggcggagaacatgatccagacctacagcaatggcagcaccaaggaccgg
aagctgctgctgacagcccagcagatgttgcaggacagtaagaccaagattgacatcatc
cgcatgcaactccgccgggcgctgcaggccggccagctggagaaccaggcagccccggat
gacacccaagggagtcctgacctgggggctgtggagctgcgcatcgaagagctgcggcac
cacttccgagtggagcacgcggtggccgagggtgccaagaacgtactgcgcctgctcagc
gctgccaaggccccggaccgcaaggcagtcagcgaggcccaggagaaattaacagaatcc
aaccagaagctggggctgctgcgggaggctctggagcggagacttggggagctgcccgcc
gaccaccccaaggggcggctgctgcgagaagagctcgctgcggcctcctccgctgccttc
agcacccgcctggccgggccctttcccgccacgcactacagcaccctgtgcaagcccgcg
ccgctcacagggaccctggaggtacgagtggtgggctgcagagacctcccagagaccatc
ccgtggaaccctaccccctcaatggggggacctgggaccccagacagccgcccccccttc
ctgagccgcccagcccggggcctttacagccgaagcggaagcctcagtggccggagcagc
ctcaaagcagaagccgagaacaccagtgaagtcagcactgtgcttaagctggataacaca
gtggtggggcagacgtcttggaagccatgtggccccaatgcctgggaccagagcttcact
ctggagctggaaagggcacgggaactggagttggctgtgttctggcgggaccagcggggc
ctgtgtgccctcaaattcctgaagttggaggatttcttggacaatgagaggcatgaggtg
cagctggacatggaaccccagggctgcctggtggctgaggtcaccttccgcaaccctgtc
attgagaggattcctcggctccgacggcagaagaaaattttctccaagcagcaagggaag
gcgttccagcgtgctaggcagatgaacatcgatgtcgccacgtgggtgcggctgctccgg
aggctcatccccaatgccacgggcacaggcacctttagccctggggcttctccaggatcc
gaggcccggaccacgggtgacatatcggtggagaagctgaacctcggcactgactcggac
agctcacctcagaagagctcgcgggatcctccttccagcccatcgagcctgagctccccc
atccaggaatccactgctcccgagctgccttcggagacccaggagaccccaggccccgcc
ctgtgcagccctctgaggaagtcacctctgaccctcgaagatttcaagttcctggcggtg
ctgggccggggtcattttgggaaggtgctcctctccgaattccggcccagtggggagctg
ttcgccatcaaggctctgaagaaaggggacattgtggcccgagacgaggtggagagcctg
atgtgtgagaagcggatattggcggcagtgaccagtgcgggacaccccttcctggtgaac
ctcttcggctgtttccagacaccggagcacgtgtgcttcgtgatggagtactcggccggt
ggggacctgatgctgcacatccacagcgacgtgttctctgagccccgtgccatcttttat
tccgcctgcgtggtgctgggcctacagtttcttcacgaacacaagatcgtctacagggac
ctgaagttggacaatttgctcctggacaccgagggctacgtcaagatcgcagactttggc
ctctgcaaggaggggatgggctatggggaccggaccagcacattctgtgggaccccggag
ttcctggcccctgaggtgctgacggacacgtcgtacacgcgagctgtggactggtgggga
ctgggtgtgctgctctacgagatgctggttggcgagtccccattcccaggggatgatgag
gaggaggtcttcgacagcatcgtcaacgacgaggttcgctacccccgcttcctgtcggcc
gaagccatcggcatcatgagaaggctgcttcggaggaacccagagcggaggctgggatct
agcgagagagatgcagaagatgtgaagaaacagcccttcttcaggactctgggctgggaa
gccctgttggcccggcgcctgccaccgccctttgtgcccacgctgtccggccgcaccgac
gtcagcaacttcgacgaggagttcaccggggaggcccccacactgagcccgccccgcgac
gcgcggcccctcacagccgcggagcaggcagccttcctggacttcgacttcgtggccggg
ggctgctag

DBGET integrated database retrieval system