KEGG   Homo sapiens (human): 55860
Entry
55860             CDS       T01001                                 

Gene name
ACTR10, ACTR11, Arp10, Arp11, HARP11
Definition
(RefSeq) actin related protein 10
  KO
K16576  actin-related protein 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
N01295  Rab7-regulated microtubule minus-end directed transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55860 (ACTR10)
   05016 Huntington disease
    55860 (ACTR10)
   05022 Pathways of neurodegeneration - multiple diseases
    55860 (ACTR10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    55860 (ACTR10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55860 (ACTR10)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    55860 (ACTR10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     55860 (ACTR10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     55860 (ACTR10)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 55860
NCBI-ProteinID: NP_060947
HGNC: 17372
Ensembl: ENSG00000131966
Vega: OTTHUMG00000171049
Pharos: Q9NZ32(Tdark)
UniProt: Q9NZ32
LinkDB
Position
14q23.1
AA seq 417 aa
MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNIN
TEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLL
APSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLL
EQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERP
SPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLA
ENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAI
FGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgccgctctacgagggcctggggagcggcggggagaagacggcggtcgtgatcgacctg
ggagaggcctttaccaagtgtggatttgctggagaaactggtccaagatgtataattcct
agtgtgataaaaagagctgggatgcctaagcctgtcagagttgttcagtataatatcaat
acagaagaattatattcctacctaaaggaattcatccacatactatatttcaggcatcta
ttggtgaatcccagagaccgccgagttgtgattatcgaatcggtattatgtccttctcac
ttcagagagacactcactcgtgttcttttcaaatattttgaggttccatctgtcttgctt
gctccaagtcatctaatggctcttctgacgcttggaattaattctgccatggtcctagat
tgtggatatagggaaagcctggtgttacccatatatgaaggaatcccagttctaaattgt
tggggagcactacccctaggaggaaaagctcttcacaaagagttggaaactcaactattg
gaacaatgtactgttgacacaagtgttgctaaagaacagagccttccctcagtgatgggt
tcagttccggaaggtgtcttagaggacattaaagcgcgtacttgctttgtaagtgatctg
aagcgaggactaaaaatccaagcagcaaaatttaatattgatgggaataatgagcgtccc
tccccacccccaaatgttgactatccattagatggagagaagattttacatatccttgga
tcaatcagagattcagttgtggaaattctttttgaacaagataatgaagagcaatcagtt
gccactttaatattggattcccttatacagtgtccgatagacaccaggaagcaactagca
gagaatttggtagtcataggtggcacttctatgttgccaggatttctccacagattgctt
gcagaaataaggtatttggtagaaaaaccaaaatataaaaaagcacttggcactaagaca
tttcgaattcatactccacctgcaaaagctaattgtgtggcctggttgggaggggctatt
tttggagcattacaagatatacttgggagccgttctgtttcaaaggaatattataatcag
acgggccgtatacctgattggtgttctctcaataacccacctttggaaatgatgtttgat
gtcgggaaaactcaaccacctctgatgaagagagcattttccactgagaaatag

DBGET integrated database retrieval system