KEGG   Homo sapiens (human): 5587Help
Entry
5587              CDS       T01001                                 

Gene name
PRKD1, CHDED, PKC-MU, PKCM, PKD, PRKCM
Definition
(RefSeq) protein kinase D1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5587 (PRKD1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    5587 (PRKD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5587 (PRKD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5587 (PRKD1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   5587 (PRKD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9
Motif
Other DBs
NCBI-GeneID: 5587
NCBI-ProteinID: NP_002733
OMIM: 605435
HGNC: 9407
Ensembl: ENSG00000184304
Vega: OTTHUMG00000140203
Pharos: Q15139(Tchem)
UniProt: Q15139
LinkDB All DBs
Position
14q12
AA seq 912 aa AA seqDB search
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccctccggtcctgcggccgcccagtccgctgctgcccgtggcggcggcagct
gccgcagcggccgccgcactggtcccagggtccgggcccgggcccgcgccgttcttggct
cctgtcgcggccccggtcgggggcatctcgttccatctgcagatcggcctgagccgtgag
ccggtgctgctgctgcaggactcgtccggggactacagcctggcgcacgtccgcgagatg
gcttgctccattgtcgaccagaagttccctgaatgtggtttctacggaatgtatgataag
atcctgctttttcgccatgaccctacctctgaaaacatccttcagctggtgaaagcggcc
agtgatatccaggaaggcgatcttattgaagtggtcttgtcagcttccgccacctttgaa
gactttcagattcgtccccacgctctctttgttcattcatacagagctccagctttctgt
gatcactgtggagaaatgctgtgggggctggtacgtcaaggtcttaaatgtgaagggtgt
ggtctgaattaccataagagatgtgcatttaaaatacccaacaattgcagcggtgtgagg
cggagaaggctctcaaacgtttccctcactggggtcagcaccatccgcacatcatctgct
gaactctctacaagtgcccctgatgagccccttctgcaaaaatcaccatcagagtcgttt
attggtcgagagaagaggtcaaattctcaatcatacattggacgaccaattcaccttgac
aagattttgatgtctaaagttaaagtgccgcacacatttgtcatccactcctacacccgg
cccacagtgtgccagtactgcaagaagcttctgaaggggcttttcaggcagggcttgcag
tgcaaagattgcagattcaactgccataaacgttgtgcaccgaaagtaccaaacaactgc
cttggcgaagtgaccattaatggagatttgcttagccctggggcagagtctgatgtggtc
atggaagaagggagtgatgacaatgatagtgaaaggaacagtgggctcatggatgatatg
gaagaagcaatggtccaagatgcagagatggcaatggcagagtgccagaacgacagtggc
gagatgcaagatccagacccagaccacgaggacgccaacagaaccatcagtccatcaaca
agcaacaatatcccactcatgagggtagtgcagtctgtcaaacacacgaagaggaaaagc
agcacagtcatgaaagaaggatggatggtccactacaccagcaaggacacgctgcggaaa
cggcactattggagattggatagcaaatgtattaccctctttcagaatgacacaggaagc
aggtactacaaggaaattcctttatctgaaattttgtctctggaaccagtaaaaacttca
gctttaattcctaatggggccaatcctcattgtttcgaaatcactacggcaaatgtagtg
tattatgtgggagaaaatgtggtcaatccttccagcccatcaccaaataacagtgttctc
accagtggcgttggtgcagatgtggccaggatgtgggagatagccatccagcatgccctt
atgcccgtcattcccaagggctcctccgtgggtacaggaaccaacttgcacagagatatc
tctgtgagtatttcagtatcaaattgccagattcaagaaaatgtggacatcagcacagta
tatcagatttttcctgatgaagtactgggttctggacagtttggaattgtttatggagga
aaacatcgtaaaacaggaagagatgtagctattaaaatcattgacaaattacgatttcca
acaaaacaagaaagccagcttcgtaatgaggttgcaattctacagaaccttcatcaccct
ggtgttgtaaatttggagtgtatgtttgagacgcctgaaagagtgtttgttgttatggaa
aaactccatggagacatgctggaaatgatcttgtcaagtgaaaagggcaggttgccagag
cacataacgaagtttttaattactcagatactcgtggctttgcggcaccttcattttaaa
aatatcgttcactgtgacctcaaaccagaaaatgtgttgctagcctcagctgatcctttt
cctcaggtgaaactttgtgattttggttttgcccggatcattggagagaagtctttccgg
aggtcagtggtgggtacccccgcttacctggctcctgaggtcctaaggaacaagggctac
aatcgctctctagacatgtggtctgttggggtcatcatctatgtaagcctaagcggcaca
ttcccatttaatgaagatgaagacatacacgaccaaattcagaatgcagctttcatgtat
ccaccaaatccctggaaggaaatatctcatgaagccattgatcttatcaacaatttgctg
caagtaaaaatgagaaagcgctacagtgtggataagaccttgagccacccttggctacag
gactatcagacctggttagatttgcgagagctggaatgcaaaatcggggagcgctacatc
acccatgaaagtgatgacctgaggtgggagaagtatgcaggcgagcaggggctgcagtac
cccacacacctgatcaatccaagtgctagccacagtgacactcctgagactgaagaaaca
gaaatgaaagccctcggtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system