KEGG   Homo sapiens (human): 55904
Entry
55904             CDS       T01001                                 

Gene name
KMT2E, HDCMC04P, MLL5, NKp44L, ODLURO
Definition
(RefSeq) lysine methyltransferase 2E (inactive)
  KO
K09189  [histone H3]-lysine4 N-trimethyltransferase MLL5 [EC:2.1.1.354]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    55904 (KMT2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    55904 (KMT2E)
   03036 Chromosome and associated proteins [BR:hsa03036]
    55904 (KMT2E)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     55904 (KMT2E)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    55904 (KMT2E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     55904 (KMT2E)
SSDB
Motif
Pfam: PHD SET PHD_2
Other DBs
NCBI-GeneID: 55904
NCBI-ProteinID: NP_061152
OMIM: 608444
HGNC: 18541
Ensembl: ENSG00000005483
Vega: OTTHUMG00000157403
Pharos: Q8IZD2(Tbio)
UniProt: Q8IZD2
LinkDB
Structure
PDB: 
4L58 5HT6 2LV9

Position
7q22.3
AA seq 1858 aa
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMEN
INSGYETRRKKGKKDKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNN
QEPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTIEPETETALAEIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDGLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPTENISGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPAVNGENKSPLLLNDSCSLPDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH
TDITPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPV
SDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDN
LIDGNCTPQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSNNGDGCA
SSNDNGEQVDHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPSSHSNHIPQLQAKGPVPSFSE
LMEDPDPENPEPTTTNECPSPDTSQNTCKSPPKMSKPGSPGSVIPAQAHGKIFTKPDPQW
DSTVSASEAENGVHLKTELQQKQLSNNNQALSKNHPPQTHVRNSSEQLSQKLPSVPTKLH
CPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLPANTQQATSGTLFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPPPPSSSYYQNQ
QPSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTIHHQ
TAAAVVPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGPVHAVTPGSHIHSQTAGHHLPPP
PPPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQALH
HPPHQGPPLFPSSAHPTVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGP
NSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
NT seq 5577 nt   +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgatacagcagagacgtcatacttggaaatggct
gcaggttcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcacatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccgacacctccggcttcccctcctcca
tcagtccttattagcaaaaatgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggatggaagttatggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagcgtt
tggcaacatattgactgcatggggattgataggcagcatattcctgatacatatctatgt
gaacgttgtcagcctaggaatttggataaagagagggcagtgctactacaacgccggaaa
agggaaaatatgtcagatggtgataccagtgcaactgagagtggtgatgaggttcctgtg
gaattatatactgcatttcagcatactccaacatcaattactttaactgcttcaagagtt
tccaaagttaatgataaaagaaggaaaaaaagcggggagaaagaacaacacatttcaaaa
tgtaaaaaggcatttcgtgaaggatctaggaagtcatcaagagttaagggttcagctcca
gagattgatccttcatctgatggttcaaattttggatgggagacaaagatcaaagcatgg
atggatcgatatgaagaagcaaataacaaccagtacagtgagggtgttcagagggaggca
caaagaatagctctgagattaggcaatggaaatgacaaaaaagagatgaataaatccgat
ttgaataccaacaatttgctcttcaaacctcctgtagagagccatatacaaaagaataag
aaaattcttaaatctgcaaaagatttgcctcctgatgcacttatcattgaatacagaggg
aagtttatgctgagagaacagtttgaagcaaatgggtatttctttaaaagaccataccct
tttgtgttattctactctaaatttcatgggctagaaatgtgtgttgatgcaaggactttt
gggaatgaggctcgattcatcaggcggtcttgtacacccaatgcagaggtgaggcatgaa
attcaagatggaaccatacatctttatatttattctatacacagtattccaaagggaact
gaaattactattgcctttgattttgactatggaaattgtaagtacaaggtggactgtgca
tgcctcaaagaaaacccagagtgccctgttctaaaacgtagttctgaatccatggaaaat
atcaatagtggttatgagaccagacggaaaaaaggaaaaaaagacaaagatatttcaaaa
gaaaaagatacacaaaatcagaatattactttggattgtgaaggaacgaccaacaaaatg
aagagcccagaaactaaacaaagaaagctttctccactgagactatcagtatcaaataat
caggaaccagattttattgatgatatagaagaaaaaactcctattagtaatgaagtagaa
atggaatcagaggagcagattgcagaaaggaaaaggaagatgacaagagaagaaagaaaa
atggaagcaattttgcaagcttttgccagacttgaaaagagagagaaaagaagagaacaa
gctttggaaaggatcagcacagccaaaactgaagttaaaactgaatgtaaagatacacag
attgtcagtgatgctgaagttattcaggaacaagcaaaagaagaaaatgctagcaagcca
acccctgccaaagtaaatagaactaaacagagaaaaagtttttctcggagtaggactcac
attggacagcagcgtcggagacacagaactgtcagcatgtgttcagatatccagccatct
tctcctgatatagaagttacttcacaacaaaatgatattgaaaatactgtacttacaata
gaaccagaaactgaaactgcactagcagaaataattactgaaactgaagttccagcactt
aataaatgtcctaccaagtaccccaaaacaaagaagcacttggttaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagatggcctttcagaaaggcctctacgcata
actacagatcctgaagtgttagctacacaactcaattctttaccaggtctcacttacagc
ccccatgtatactccactcctaagcattatattagatttacttcaccattcctttcagaa
aaaaggagaagaaaagaacctactgaaaacatttctggttcatgcaagaagcgatggttg
aaacaagctctggaagaagaaaattcagcaattttacatagatttaattcaccctgtcaa
gaaagatccagaagtcctgcagtcaatggtgaaaataaaagtccactactattaaatgac
agctgttcccttccagatttaactacaccactaaaaaaacgaagattttatcagttgcta
gattcggtttactcagaaacctccacacctactccttccccgtatgctacaccaactcac
accgatattactcctatggacccatcttttgccacgcctccacggataaaatcagatgat
gaaacttgtagaaatggttataaacccatatattcaccagttaccccagtaactcctggt
acaccaggaaataccatgcactttgagaatatttcttccccagaaagttctccagaaata
aagagacgcacttatagtcaagagggatatgacagatcttcaaccatgttaacattgggg
ccttttagaaattctaatttaactgaactgggtctgcaagaaataaagactattggttat
acgagccctaggagtaggactgaagtcaacaggcagtgtcctggagaaaaggaacctgtg
tcagaccttcagctaggactcgatgcagttgagccaactgccctacataaaaccctggaa
acgcctgcacatgacagggctgagcccaacagccaactggactcgactcactctggacgg
ggcacaatgtattcttcctgggtaaagagccctgacagaacaggagttaacttctcagtg
aactccaacttgagggacctgacaccctcgcatcagttggaggttggaggaggcttccga
ataagtgagtcaaagtgcctgatgcaggatgatactagaggcatgtttatggaaacaact
gtgttttgtacttccgaagatgggcttgtatctggtttcggacggactgttaatgacaat
ttgatcgacgggaattgcacaccccagaatccaccacaaaagaaaaaggtttctctatta
gaataccgtaagagacaacgtgaagctaggaaaagtggctctaagacagagaactttcca
ctcattagtgtatcaccccatgcaagtggaagcttgagcaacaatggtgatggctgtgcc
agcagtaatgacaatggggagcaggtggaccacactgctagcctacctttaccaacacca
gctacagtttataatgccacttctgaagaaactagcaataactgccctgttaaggatgct
actgctagtgagaagaatgaaccagaagttcaatggactgcctcaacttcagtggaacaa
gtcagagaaaggagttatcagagagctttacttctcagtgatcaccgaaaagataaagat
agtgggggagaatcaccatgtgtctcatgttcaccgagtcatgttcagtcttcaccttca
tctcattcaaatcacataccccagttgcaagctaagggcccagtcccttctttcagtgaa
cttatggaagaccctgatcctgaaaatccagaacccacaactacgaatgaatgtccatcc
ccagatacttctcaaaatacttgtaaaagtcctccaaaaatgagcaagcctggttcacct
ggatctgtaattcctgctcaagcacacgggaaaatattcacaaaaccagatccccaatgg
gactccacagttagtgcatccgaagctgaaaatggtgttcacctaaaaacagagctccaa
caaaaacagctatcaaataacaaccaagcactttcaaagaatcatcctcctcagacacac
gttcgtaattcatctgagcaactttcacaaaagctgccttctgtgccaacaaagttgcac
tgtcctccatcacctcacctagaaaatcctccaaagtcatccacgcctcacacacctgta
cagcatggttatctttcaccaaagcctccttcacagcagttaggatctccctacaggcct
catcattcacagtcacctcaagttggaacacctcagcgagagcctcaaagaaacttttat
ccagcagcacagaaccttccagccaatactcagcaggcaacttctggaacattatttaca
cagacaccctcaggacaatcttcagcaacatacagtcagtttaaccaacaaagtctgaac
agcacggcaccaccccctccacctcctccacctccttcttcgtcttactatcaaaaccag
cagccctctgcaaactttcagaattataatcagctcaaaggtagtctttctcaacaaact
gtgtttacatcaggaccaaatcaagcacttcctggcaccacaagccagcaaacagttcca
ggacaccacgtgactccagggcattttttgccctctcagaaccctaccattcaccatcaa
actgctgctgccgtagtcccccctcctcctccaccaccacctgctccaggaccgcacctt
gtacaacagccgaattcccatcagcaacactctgtagcacatgtagtagggcctgttcat
gcggtcacccctgggtcgcatattcattctcaaactgctggacaccacttacccccaccc
ccaccccctcctggtcctgcccctcatcaccatccaccaccccatccatccacaggactc
caaggtctacaagcacaacaccagcatgttgtaaattcagcacccccaccaccccctccg
ccgccaccttccagtgttttggcttctgggcatcataccacatcagctcaagccttacac
cacccacctcatcaaggacctccactttttccttcgagtgctcatccaactgtaccaccg
tatccctcacaagctacacatcataccactttgggaccgggaccccagcaccagccttct
ggaacagggccacattgtccattacctgtcacaggtcctcatctccagccccaaggacca
aacagtattccaacacctactgcttcagggttctgtcctcatcctggctctgtggccctg
ccacatggggttcaaggacctcagcaggcatctccagtgcctggacagattccaattcac
agagcacaggtgccaccaacatttcaaaacaattaccatgggtcagggtggcattaa

DBGET integrated database retrieval system