KEGG   Homo sapiens (human): 5594Help
Entry
5594              CDS       T01001                                 

Gene name
MAPK1, ERK, ERK-2, ERK2, ERT1, MAPK2, P42MAPK, PRKM1, PRKM2, p38, p40, p41, p41mapk, p42-MAPK
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04540  Gap junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04929  GnRH secretion
hsa04930  Type II diabetes mellitus
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05010  Alzheimer disease
hsa05020  Prion diseases
hsa05034  Alcoholism
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling
nt06224  CXCR signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
nt06310  CRH-ACTH-cortisol signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06360  Cushing syndrome
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00006  Amplified EGFR to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00008  RET-PTC fusion kinase to RAS-ERK signaling pathway
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00013  Mutation-activated BRAF to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00018  Amplified PDGFR to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00041  EGFR-overexpression to RAS-ERK signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00152  CXCR-GNB/G-ERK signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00160  KSHV K1 to RAS-ERK signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00233  IGF-IGF1R-RAS-ERK signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00248  MET-overexpression to RAS-ERK signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00259  Amplified MET to RAS-ERK signaling pathway
N00274  HCV NS5A to RAS-ERK signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
N00318  EGFR-ERK-ACTH signaling pathway
N00319  Mutation-activated USP8 to EGFR-ERK-ACTH signaling pathway
N00367  HPV E5 to EGFR-RAS-ERK signaling pathway
N00369  HPV E5 to PDGFR-RAS-ERK signaling pathway
N00386  HCMV gB to PDGFR-RAS-ERK signaling pathway
N00392  HCMV gB to EGFR-RAS-ERK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00513  Mutation-activated EGFR to RAS-ERK signaling pathway
N00518  HCV Core to ERK signaling pathway
N00519  HCV Core to ERK signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N00541  HBV HBx to RAS-ERK signaling pathway
N00545  HBV HBx to ERK signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
N00547  HBV LHBs to PKC-ERK signaling pathway
N00744  IAV HA to ERK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
N00876  Mutation-inactivated FGF8 to RAS-ERK signaling pathway
N00877  Mutation-inactivated FGF17 to RAS-ERK signaling pathway
N00878  Mutation-inactivated FGFR1 to RAS-ERK signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
N00913  Mutation-inactivated IGF1 to RAS-ERK signaling pathway
N00914  Mutation-inactivated IGF1R to RAS-ERK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Drug target
Ravoxertinib: D11285
Ulixertinib: D11038
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5594 (MAPK1)
   04015 Rap1 signaling pathway
    5594 (MAPK1)
   04010 MAPK signaling pathway
    5594 (MAPK1)
   04012 ErbB signaling pathway
    5594 (MAPK1)
   04350 TGF-beta signaling pathway
    5594 (MAPK1)
   04370 VEGF signaling pathway
    5594 (MAPK1)
   04371 Apelin signaling pathway
    5594 (MAPK1)
   04668 TNF signaling pathway
    5594 (MAPK1)
   04066 HIF-1 signaling pathway
    5594 (MAPK1)
   04068 FoxO signaling pathway
    5594 (MAPK1)
   04072 Phospholipase D signaling pathway
    5594 (MAPK1)
   04071 Sphingolipid signaling pathway
    5594 (MAPK1)
   04024 cAMP signaling pathway
    5594 (MAPK1)
   04022 cGMP-PKG signaling pathway
    5594 (MAPK1)
   04151 PI3K-Akt signaling pathway
    5594 (MAPK1)
   04150 mTOR signaling pathway
    5594 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5594 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5594 (MAPK1)
   04210 Apoptosis
    5594 (MAPK1)
   04218 Cellular senescence
    5594 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5594 (MAPK1)
   04520 Adherens junction
    5594 (MAPK1)
   04540 Gap junction
    5594 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    5594 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5594 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5594 (MAPK1)
   04620 Toll-like receptor signaling pathway
    5594 (MAPK1)
   04621 NOD-like receptor signaling pathway
    5594 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    5594 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    5594 (MAPK1)
   04660 T cell receptor signaling pathway
    5594 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    5594 (MAPK1)
   04659 Th17 cell differentiation
    5594 (MAPK1)
   04657 IL-17 signaling pathway
    5594 (MAPK1)
   04662 B cell receptor signaling pathway
    5594 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    5594 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    5594 (MAPK1)
   04062 Chemokine signaling pathway
    5594 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5594 (MAPK1)
   04929 GnRH secretion
    5594 (MAPK1)
   04912 GnRH signaling pathway
    5594 (MAPK1)
   04915 Estrogen signaling pathway
    5594 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    5594 (MAPK1)
   04917 Prolactin signaling pathway
    5594 (MAPK1)
   04921 Oxytocin signaling pathway
    5594 (MAPK1)
   04926 Relaxin signaling pathway
    5594 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    5594 (MAPK1)
   04919 Thyroid hormone signaling pathway
    5594 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    5594 (MAPK1)
   04916 Melanogenesis
    5594 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5594 (MAPK1)
   04270 Vascular smooth muscle contraction
    5594 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5594 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    5594 (MAPK1)
   04725 Cholinergic synapse
    5594 (MAPK1)
   04726 Serotonergic synapse
    5594 (MAPK1)
   04720 Long-term potentiation
    5594 (MAPK1)
   04730 Long-term depression
    5594 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    5594 (MAPK1)
   04722 Neurotrophin signaling pathway
    5594 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    5594 (MAPK1)
   04380 Osteoclast differentiation
    5594 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5594 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5594 (MAPK1)
   05206 MicroRNAs in cancer
    5594 (MAPK1)
   05205 Proteoglycans in cancer
    5594 (MAPK1)
   05203 Viral carcinogenesis
    5594 (MAPK1)
   05230 Central carbon metabolism in cancer
    5594 (MAPK1)
   05231 Choline metabolism in cancer
    5594 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5594 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5594 (MAPK1)
   05212 Pancreatic cancer
    5594 (MAPK1)
   05225 Hepatocellular carcinoma
    5594 (MAPK1)
   05226 Gastric cancer
    5594 (MAPK1)
   05214 Glioma
    5594 (MAPK1)
   05216 Thyroid cancer
    5594 (MAPK1)
   05221 Acute myeloid leukemia
    5594 (MAPK1)
   05220 Chronic myeloid leukemia
    5594 (MAPK1)
   05218 Melanoma
    5594 (MAPK1)
   05211 Renal cell carcinoma
    5594 (MAPK1)
   05219 Bladder cancer
    5594 (MAPK1)
   05215 Prostate cancer
    5594 (MAPK1)
   05213 Endometrial cancer
    5594 (MAPK1)
   05224 Breast cancer
    5594 (MAPK1)
   05223 Non-small cell lung cancer
    5594 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5594 (MAPK1)
   05020 Prion diseases
    5594 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    5594 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5594 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5594 (MAPK1)
   04934 Cushing syndrome
    5594 (MAPK1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5594 (MAPK1)
   05132 Salmonella infection
    5594 (MAPK1)
   05131 Shigellosis
    5594 (MAPK1)
   05135 Yersinia infection
    5594 (MAPK1)
   05133 Pertussis
    5594 (MAPK1)
   05152 Tuberculosis
    5594 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5594 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    5594 (MAPK1)
   05164 Influenza A
    5594 (MAPK1)
   05161 Hepatitis B
    5594 (MAPK1)
   05160 Hepatitis C
    5594 (MAPK1)
   05163 Human cytomegalovirus infection
    5594 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5594 (MAPK1)
   05165 Human papillomavirus infection
    5594 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5594 (MAPK1)
   05140 Leishmaniasis
    5594 (MAPK1)
   05142 Chagas disease (American trypanosomiasis)
    5594 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5594 (MAPK1)
   01524 Platinum drug resistance
    5594 (MAPK1)
   01522 Endocrine resistance
    5594 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5594 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5594 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5594 (MAPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5594 (MAPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5594 (MAPK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     5594 (MAPK1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5594 (MAPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 5594
NCBI-ProteinID: NP_002736
OMIM: 176948
HGNC: 6871
Ensembl: ENSG00000100030
Vega: OTTHUMG00000030508
Pharos: P28482(Tchem)
UniProt: P28482 Q1HBJ4 Q499G7
LinkDB All DBs
Structure
PDB: 

Position
22q11.22
AA seq 360 aa AA seqDB search
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagcccctttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctttacaagctcttgaagacacaacac
ctcagcaatgaccatatctgctattttctctaccagatcctcagagggttaaaatatatc
cattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagaccatgatcac
acagggttcctgacagaatatgtggccacacgttggtacagggctccagaaattatgttg
aattccaagggctacaccaagtccattgatatttggtctgtaggctgcattctggcagaa
atgctttctaacaggcccatctttccagggaagcattatcttgaccagctgaaccacatt
ttgggtattcttggatccccatcacaagaagacctgaattgtataataaatttaaaagct
aggaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttattggacaaaatgttgacattcaacccacacaag
aggattgaagtagaacaggctctggcccacccatatctggagcagtattacgacccgagt
gacgagcccatcgccgaagcaccattcaagttcgacatggaattggatgacttgcctaag
gaaaagctcaaagaactaatttttgaagagactgctagattccagccaggatacagatct
taa

KEGG   Homo sapiens (human): 5595Help
Entry
5595              CDS       T01001                                 

Gene name
MAPK3, ERK-1, ERK1, ERT2, HS44KDAP, HUMKER1A, P44ERK1, P44MAPK, PRKM3, p44-ERK1, p44-MAPK
Definition
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04540  Gap junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04929  GnRH secretion
hsa04930  Type II diabetes mellitus
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05010  Alzheimer disease
hsa05020  Prion diseases
hsa05034  Alcoholism
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling
nt06224  CXCR signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
nt06310  CRH-ACTH-cortisol signaling
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
nt06324  GHRH-GH-IGF signaling
nt06360  Cushing syndrome
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00006  Amplified EGFR to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00008  RET-PTC fusion kinase to RAS-ERK signaling pathway
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00013  Mutation-activated BRAF to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00018  Amplified PDGFR to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00041  EGFR-overexpression to RAS-ERK signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00152  CXCR-GNB/G-ERK signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00160  KSHV K1 to RAS-ERK signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00233  IGF-IGF1R-RAS-ERK signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00248  MET-overexpression to RAS-ERK signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00259  Amplified MET to RAS-ERK signaling pathway
N00274  HCV NS5A to RAS-ERK signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
N00318  EGFR-ERK-ACTH signaling pathway
N00319  Mutation-activated USP8 to EGFR-ERK-ACTH signaling pathway
N00367  HPV E5 to EGFR-RAS-ERK signaling pathway
N00369  HPV E5 to PDGFR-RAS-ERK signaling pathway
N00386  HCMV gB to PDGFR-RAS-ERK signaling pathway
N00392  HCMV gB to EGFR-RAS-ERK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00513  Mutation-activated EGFR to RAS-ERK signaling pathway
N00518  HCV Core to ERK signaling pathway
N00519  HCV Core to ERK signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N00541  HBV HBx to RAS-ERK signaling pathway
N00545  HBV HBx to ERK signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
N00547  HBV LHBs to PKC-ERK signaling pathway
N00744  IAV HA to ERK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
N00876  Mutation-inactivated FGF8 to RAS-ERK signaling pathway
N00877  Mutation-inactivated FGF17 to RAS-ERK signaling pathway
N00878  Mutation-inactivated FGFR1 to RAS-ERK signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
N00913  Mutation-inactivated IGF1 to RAS-ERK signaling pathway
N00914  Mutation-inactivated IGF1R to RAS-ERK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Drug target
Ravoxertinib: D11285
Ulixertinib: D11038
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5595 (MAPK3)
   04015 Rap1 signaling pathway
    5595 (MAPK3)
   04010 MAPK signaling pathway
    5595 (MAPK3)
   04012 ErbB signaling pathway
    5595 (MAPK3)
   04350 TGF-beta signaling pathway
    5595 (MAPK3)
   04370 VEGF signaling pathway
    5595 (MAPK3)
   04371 Apelin signaling pathway
    5595 (MAPK3)
   04668 TNF signaling pathway
    5595 (MAPK3)
   04066 HIF-1 signaling pathway
    5595 (MAPK3)
   04068 FoxO signaling pathway
    5595 (MAPK3)
   04072 Phospholipase D signaling pathway
    5595 (MAPK3)
   04071 Sphingolipid signaling pathway
    5595 (MAPK3)
   04024 cAMP signaling pathway
    5595 (MAPK3)
   04022 cGMP-PKG signaling pathway
    5595 (MAPK3)
   04151 PI3K-Akt signaling pathway
    5595 (MAPK3)
   04150 mTOR signaling pathway
    5595 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5595 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    5595 (MAPK3)
   04210 Apoptosis
    5595 (MAPK3)
   04218 Cellular senescence
    5595 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5595 (MAPK3)
   04520 Adherens junction
    5595 (MAPK3)
   04540 Gap junction
    5595 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    5595 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5595 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5595 (MAPK3)
   04620 Toll-like receptor signaling pathway
    5595 (MAPK3)
   04621 NOD-like receptor signaling pathway
    5595 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    5595 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    5595 (MAPK3)
   04660 T cell receptor signaling pathway
    5595 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    5595 (MAPK3)
   04659 Th17 cell differentiation
    5595 (MAPK3)
   04657 IL-17 signaling pathway
    5595 (MAPK3)
   04662 B cell receptor signaling pathway
    5595 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    5595 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    5595 (MAPK3)
   04062 Chemokine signaling pathway
    5595 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5595 (MAPK3)
   04929 GnRH secretion
    5595 (MAPK3)
   04912 GnRH signaling pathway
    5595 (MAPK3)
   04915 Estrogen signaling pathway
    5595 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    5595 (MAPK3)
   04917 Prolactin signaling pathway
    5595 (MAPK3)
   04921 Oxytocin signaling pathway
    5595 (MAPK3)
   04926 Relaxin signaling pathway
    5595 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    5595 (MAPK3)
   04919 Thyroid hormone signaling pathway
    5595 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    5595 (MAPK3)
   04916 Melanogenesis
    5595 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5595 (MAPK3)
   04270 Vascular smooth muscle contraction
    5595 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5595 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    5595 (MAPK3)
   04725 Cholinergic synapse
    5595 (MAPK3)
   04726 Serotonergic synapse
    5595 (MAPK3)
   04720 Long-term potentiation
    5595 (MAPK3)
   04730 Long-term depression
    5595 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    5595 (MAPK3)
   04722 Neurotrophin signaling pathway
    5595 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    5595 (MAPK3)
   04380 Osteoclast differentiation
    5595 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5595 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5595 (MAPK3)
   05206 MicroRNAs in cancer
    5595 (MAPK3)
   05205 Proteoglycans in cancer
    5595 (MAPK3)
   05203 Viral carcinogenesis
    5595 (MAPK3)
   05230 Central carbon metabolism in cancer
    5595 (MAPK3)
   05231 Choline metabolism in cancer
    5595 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5595 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5595 (MAPK3)
   05212 Pancreatic cancer
    5595 (MAPK3)
   05225 Hepatocellular carcinoma
    5595 (MAPK3)
   05226 Gastric cancer
    5595 (MAPK3)
   05214 Glioma
    5595 (MAPK3)
   05216 Thyroid cancer
    5595 (MAPK3)
   05221 Acute myeloid leukemia
    5595 (MAPK3)
   05220 Chronic myeloid leukemia
    5595 (MAPK3)
   05218 Melanoma
    5595 (MAPK3)
   05211 Renal cell carcinoma
    5595 (MAPK3)
   05219 Bladder cancer
    5595 (MAPK3)
   05215 Prostate cancer
    5595 (MAPK3)
   05213 Endometrial cancer
    5595 (MAPK3)
   05224 Breast cancer
    5595 (MAPK3)
   05223 Non-small cell lung cancer
    5595 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5595 (MAPK3)
   05020 Prion diseases
    5595 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    5595 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5595 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5595 (MAPK3)
   04934 Cushing syndrome
    5595 (MAPK3)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5595 (MAPK3)
   05132 Salmonella infection
    5595 (MAPK3)
   05131 Shigellosis
    5595 (MAPK3)
   05135 Yersinia infection
    5595 (MAPK3)
   05133 Pertussis
    5595 (MAPK3)
   05152 Tuberculosis
    5595 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5595 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    5595 (MAPK3)
   05164 Influenza A
    5595 (MAPK3)
   05161 Hepatitis B
    5595 (MAPK3)
   05160 Hepatitis C
    5595 (MAPK3)
   05163 Human cytomegalovirus infection
    5595 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5595 (MAPK3)
   05165 Human papillomavirus infection
    5595 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5595 (MAPK3)
   05140 Leishmaniasis
    5595 (MAPK3)
   05142 Chagas disease (American trypanosomiasis)
    5595 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5595 (MAPK3)
   01524 Platinum drug resistance
    5595 (MAPK3)
   01522 Endocrine resistance
    5595 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5595 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5595 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5595 (MAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5595 (MAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5595 (MAPK3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     5595 (MAPK3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5595 (MAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo FTA2 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 5595
NCBI-ProteinID: NP_002737
OMIM: 601795
HGNC: 6877
Ensembl: ENSG00000102882
Vega: OTTHUMG00000132149
Pharos: P27361(Tchem)
UniProt: P27361 L7RXH5
LinkDB All DBs
Structure
PDB: 

Position
16p11.2
AA seq 379 aa AA seqDB search
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgaacatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgggcgtccaccctggaagccatgagagatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagcaat
gaccatatctgctacttcctctaccagatcctgcggggcctcaagtacatccactccgcc
aacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgtgatttcggcctggcccggattgccgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggccccctag

KEGG   Homo sapiens (human): 1432Help
Entry
1432              CDS       T01001                                 

Gene name
MAPK14, CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00445  HIV Tat/Nef to TNF-p38 signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00931  Escherichia NleD to TNF-p38 signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Pamapimod: D08963
Ralimetinib (DG01847): D10658 D10659
Talmapimod: D09386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1432 (MAPK14)
   04010 MAPK signaling pathway
    1432 (MAPK14)
   04370 VEGF signaling pathway
    1432 (MAPK14)
   04668 TNF signaling pathway
    1432 (MAPK14)
   04068 FoxO signaling pathway
    1432 (MAPK14)
   04071 Sphingolipid signaling pathway
    1432 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    1432 (MAPK14)
   04218 Cellular senescence
    1432 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    1432 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    1432 (MAPK14)
   04620 Toll-like receptor signaling pathway
    1432 (MAPK14)
   04621 NOD-like receptor signaling pathway
    1432 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    1432 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    1432 (MAPK14)
   04660 T cell receptor signaling pathway
    1432 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    1432 (MAPK14)
   04659 Th17 cell differentiation
    1432 (MAPK14)
   04657 IL-17 signaling pathway
    1432 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    1432 (MAPK14)
   04670 Leukocyte transendothelial migration
    1432 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    1432 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    1432 (MAPK14)
   04917 Prolactin signaling pathway
    1432 (MAPK14)
   04926 Relaxin signaling pathway
    1432 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    1432 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1432 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    1432 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    1432 (MAPK14)
   04722 Neurotrophin signaling pathway
    1432 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    1432 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1432 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    1432 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    1432 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    1432 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    1432 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    1432 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1432 (MAPK14)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1432 (MAPK14)
   05130 Pathogenic Escherichia coli infection
    1432 (MAPK14)
   05132 Salmonella infection
    1432 (MAPK14)
   05131 Shigellosis
    1432 (MAPK14)
   05135 Yersinia infection
    1432 (MAPK14)
   05133 Pertussis
    1432 (MAPK14)
   05152 Tuberculosis
    1432 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1432 (MAPK14)
   05161 Hepatitis B
    1432 (MAPK14)
   05163 Human cytomegalovirus infection
    1432 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1432 (MAPK14)
   05169 Epstein-Barr virus infection
    1432 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    1432 (MAPK14)
   05140 Leishmaniasis
    1432 (MAPK14)
   05142 Chagas disease (American trypanosomiasis)
    1432 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1432 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1432 (MAPK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     1432 (MAPK14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   1432 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 1432
NCBI-ProteinID: NP_001306
OMIM: 600289
HGNC: 6876
Ensembl: ENSG00000112062
Vega: OTTHUMG00000159806
Pharos: Q16539(Tchem)
UniProt: Q16539 L7RSM2
LinkDB All DBs
Structure
PDB: 
2FST 6SFI 5WJJ 4EHV 3ZS5 3OEF 6HWT 6HWV 5XYY 3ROC 3K3I 3FMK 2QD9 2FSL 2RG6 6SFO 2GFS 6SFK 6M95 5MTX 4AA0 3S3I 3KQ7 3HUC 3GC7 3FLY 3FL4 2ZAZ 2NPQ 2FSO 5N68 4F9Y 2FSM 4E5A 3HL7 3ZSG 3NNW 3MPT 5N67 5ML5 3ZYA 3FMH 3FMN 3FLN 3FLQ 3D83 4DLI 6SFJ 2Y8O 3HV6 3HLL 4KIN 6ANL 5OMG 5O8U 5O8V 5N65 4F9W 4FA2 4EH2 4EH5 4E5B 2YIW 2YIS 3QUD 3O8T 3MVM 3MH0 3KF7 3K3J 3FSK 3FMJ 3FMM 3FKL 3FKN 3FKO 3E92 3E93 2OKR 2I0H 1ZZL 1ZZ2 1ZYJ 1YQJ 1WBT 1R3C 1IAN 3ZSH 4R3C 4E6A 3NWW 5TCO 4L8M 4EWQ 4EH6 4EH7 4EH9 3UVR 3O8P 3O8U 3NNV 3MPA 3MGY 3LFA 3IPH 3HVC 3GFE 3GCU 3FSF 3FML 3FLW 3D7Z 2ZB0 2BAL 1OZ1 1OVE 5MZ3 4ZTH 3U8W 3HP2 1WBO 4EH8 3UVQ 4A9Y 3RIN 3ODY 3MH1 3MH3 3HRB 3HEG 3FI4 2BAK 1W82 1W84 3OCG 1W7H 3FLZ 3ITZ 3HV5 2BAJ 4KIP 3S4Q 3NNX 6HWU 4AA4 2YIX 3ODZ 3MH2 3HP5 3FLS 1R39 1WFC 5MTY 4AA5 4E6C 5N63 5N64 5N66 5ETF 4EH3 3UVP 3ZSI 3OBJ 3NNU 3L8X 3HV7 3GI3 3FC1 3BX5 3BV2 2RG5 1M7Q 1BMK 1WBW 5ETC 5TBE 6M9L 3HA8 5OMH 4KIQ 4EH4 4AAC 3HEC 2ZB1 1W83 1OUY 1OUK 1KV1 1BL7 1BL6 1A9U 3NEW 3OC1 3BV3 4DLJ 3HV4 1DI9 5XYX 3OD6 4E8A 3QUE 5ETA 5ETI 3OBG 3MW1 3MVL 3DT1 3C5U 2BAQ 1KV2 3DS6 3LHJ 2ONL 2LGC 1WBS 1WBV 1WBN
Thumbnails

Position
6p21.31
AA seq 360 aa AA seqDB search
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Homo sapiens (human): 5600Help
Entry
5600              CDS       T01001                                 

Gene name
MAPK11, P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
  Element
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5600 (MAPK11)
   04010 MAPK signaling pathway
    5600 (MAPK11)
   04370 VEGF signaling pathway
    5600 (MAPK11)
   04668 TNF signaling pathway
    5600 (MAPK11)
   04068 FoxO signaling pathway
    5600 (MAPK11)
   04071 Sphingolipid signaling pathway
    5600 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5600 (MAPK11)
   04218 Cellular senescence
    5600 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5600 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5600 (MAPK11)
   04620 Toll-like receptor signaling pathway
    5600 (MAPK11)
   04621 NOD-like receptor signaling pathway
    5600 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    5600 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    5600 (MAPK11)
   04660 T cell receptor signaling pathway
    5600 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    5600 (MAPK11)
   04659 Th17 cell differentiation
    5600 (MAPK11)
   04657 IL-17 signaling pathway
    5600 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    5600 (MAPK11)
   04670 Leukocyte transendothelial migration
    5600 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5600 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    5600 (MAPK11)
   04917 Prolactin signaling pathway
    5600 (MAPK11)
   04926 Relaxin signaling pathway
    5600 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    5600 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5600 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    5600 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    5600 (MAPK11)
   04722 Neurotrophin signaling pathway
    5600 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5600 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5600 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    5600 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    5600 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5600 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    5600 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5600 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5600 (MAPK11)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5600 (MAPK11)
   05130 Pathogenic Escherichia coli infection
    5600 (MAPK11)
   05132 Salmonella infection
    5600 (MAPK11)
   05131 Shigellosis
    5600 (MAPK11)
   05135 Yersinia infection
    5600 (MAPK11)
   05133 Pertussis
    5600 (MAPK11)
   05152 Tuberculosis
    5600 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5600 (MAPK11)
   05161 Hepatitis B
    5600 (MAPK11)
   05163 Human cytomegalovirus infection
    5600 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5600 (MAPK11)
   05169 Epstein-Barr virus infection
    5600 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5600 (MAPK11)
   05140 Leishmaniasis
    5600 (MAPK11)
   05142 Chagas disease (American trypanosomiasis)
    5600 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5600 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5600 (MAPK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5600 (MAPK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5600 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5600
NCBI-ProteinID: NP_002742
OMIM: 602898
HGNC: 6873
Ensembl: ENSG00000185386
Vega: OTTHUMG00000150226
Pharos: Q15759(Tchem)
UniProt: Q15759
LinkDB All DBs
Structure
PDB: 

Position
22q13.33
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggattttgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcagct
gaggcactggcccacgcctacttcagccagtaccacgaccccgaggatgagccagaggcc
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Homo sapiens (human): 5603Help
Entry
5603              CDS       T01001                                 

Gene name
MAPK13, MAPK_13, MAPK-13, PRKM13, SAPK4, p38delta
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
  Element
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5603 (MAPK13)
   04010 MAPK signaling pathway
    5603 (MAPK13)
   04370 VEGF signaling pathway
    5603 (MAPK13)
   04668 TNF signaling pathway
    5603 (MAPK13)
   04068 FoxO signaling pathway
    5603 (MAPK13)
   04071 Sphingolipid signaling pathway
    5603 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5603 (MAPK13)
   04218 Cellular senescence
    5603 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5603 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5603 (MAPK13)
   04620 Toll-like receptor signaling pathway
    5603 (MAPK13)
   04621 NOD-like receptor signaling pathway
    5603 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    5603 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    5603 (MAPK13)
   04660 T cell receptor signaling pathway
    5603 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    5603 (MAPK13)
   04659 Th17 cell differentiation
    5603 (MAPK13)
   04657 IL-17 signaling pathway
    5603 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    5603 (MAPK13)
   04670 Leukocyte transendothelial migration
    5603 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5603 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    5603 (MAPK13)
   04917 Prolactin signaling pathway
    5603 (MAPK13)
   04926 Relaxin signaling pathway
    5603 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    5603 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5603 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    5603 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    5603 (MAPK13)
   04722 Neurotrophin signaling pathway
    5603 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5603 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5603 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    5603 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    5603 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5603 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    5603 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5603 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5603 (MAPK13)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5603 (MAPK13)
   05130 Pathogenic Escherichia coli infection
    5603 (MAPK13)
   05132 Salmonella infection
    5603 (MAPK13)
   05131 Shigellosis
    5603 (MAPK13)
   05135 Yersinia infection
    5603 (MAPK13)
   05133 Pertussis
    5603 (MAPK13)
   05152 Tuberculosis
    5603 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5603 (MAPK13)
   05161 Hepatitis B
    5603 (MAPK13)
   05163 Human cytomegalovirus infection
    5603 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5603 (MAPK13)
   05169 Epstein-Barr virus infection
    5603 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5603 (MAPK13)
   05140 Leishmaniasis
    5603 (MAPK13)
   05142 Chagas disease (American trypanosomiasis)
    5603 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5603 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5603 (MAPK13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5603 (MAPK13)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5603 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase DUF4023 DUF3231
Motif
Other DBs
NCBI-GeneID: 5603
NCBI-ProteinID: NP_002745
OMIM: 602899
HGNC: 6875
Ensembl: ENSG00000156711
Vega: OTTHUMG00000014587
Pharos: O15264(Tchem)
UniProt: O15264 A0A024RD04
LinkDB All DBs
Structure
PDB: 

Position
6p21.31
AA seq 365 aa AA seqDB search
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagacagcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
tatgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactctgctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

KEGG   Homo sapiens (human): 6300Help
Entry
6300              CDS       T01001                                 

Gene name
MAPK12, ERK-6, ERK3, ERK6, MAPK_12, P38GAMMA, PRKM12, SAPK-3, SAPK3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04218  Cellular senescence
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04611  Platelet activation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04714  Thermogenesis
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
  Element
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Drug target
Dilmapimod (DG01409): D09602 D09603
Doramapimod: D03736
Losmapimod: D09639
Neflamapimod: D10959
Ralimetinib (DG01847): D10658 D10659
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    6300 (MAPK12)
   04010 MAPK signaling pathway
    6300 (MAPK12)
   04370 VEGF signaling pathway
    6300 (MAPK12)
   04668 TNF signaling pathway
    6300 (MAPK12)
   04068 FoxO signaling pathway
    6300 (MAPK12)
   04071 Sphingolipid signaling pathway
    6300 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    6300 (MAPK12)
   04218 Cellular senescence
    6300 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6300 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6300 (MAPK12)
   04620 Toll-like receptor signaling pathway
    6300 (MAPK12)
   04621 NOD-like receptor signaling pathway
    6300 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    6300 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    6300 (MAPK12)
   04660 T cell receptor signaling pathway
    6300 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    6300 (MAPK12)
   04659 Th17 cell differentiation
    6300 (MAPK12)
   04657 IL-17 signaling pathway
    6300 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    6300 (MAPK12)
   04670 Leukocyte transendothelial migration
    6300 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6300 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    6300 (MAPK12)
   04917 Prolactin signaling pathway
    6300 (MAPK12)
   04926 Relaxin signaling pathway
    6300 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    6300 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    6300 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    6300 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    6300 (MAPK12)
   04722 Neurotrophin signaling pathway
    6300 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6300 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    6300 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    6300 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6300 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    6300 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    6300 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6300 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6300 (MAPK12)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6300 (MAPK12)
   05130 Pathogenic Escherichia coli infection
    6300 (MAPK12)
   05132 Salmonella infection
    6300 (MAPK12)
   05131 Shigellosis
    6300 (MAPK12)
   05135 Yersinia infection
    6300 (MAPK12)
   05133 Pertussis
    6300 (MAPK12)
   05152 Tuberculosis
    6300 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6300 (MAPK12)
   05161 Hepatitis B
    6300 (MAPK12)
   05163 Human cytomegalovirus infection
    6300 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6300 (MAPK12)
   05169 Epstein-Barr virus infection
    6300 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    6300 (MAPK12)
   05140 Leishmaniasis
    6300 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    6300 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    6300 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6300 (MAPK12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     6300 (MAPK12)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   6300 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase Peripla_BP_5 UvrD_C
Motif
Other DBs
NCBI-GeneID: 6300
NCBI-ProteinID: NP_002960
OMIM: 602399
HGNC: 6874
Ensembl: ENSG00000188130
Vega: OTTHUMG00000030145
Pharos: P53778(Tchem)
UniProt: P53778
LinkDB All DBs
Structure
PDB: 

Position
22q13.33
AA seq 367 aa AA seqDB search
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacggccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cctttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcaggcgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgttgaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacgcctctgtga

KEGG   Homo sapiens (human): 5599Help
Entry
5599              CDS       T01001                                 

Gene name
MAPK8, JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00930  Escherichia NleD to TNF-JNK signaling pathway
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5599 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5599 (MAPK8)
   04010 MAPK signaling pathway
    5599 (MAPK8)
   04012 ErbB signaling pathway
    5599 (MAPK8)
   04310 Wnt signaling pathway
    5599 (MAPK8)
   04668 TNF signaling pathway
    5599 (MAPK8)
   04068 FoxO signaling pathway
    5599 (MAPK8)
   04071 Sphingolipid signaling pathway
    5599 (MAPK8)
   04024 cAMP signaling pathway
    5599 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5599 (MAPK8)
   04137 Mitophagy - animal
    5599 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    5599 (MAPK8)
   04215 Apoptosis - multiple species
    5599 (MAPK8)
   04217 Necroptosis
    5599 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5599 (MAPK8)
   04530 Tight junction
    5599 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5599 (MAPK8)
   04621 NOD-like receptor signaling pathway
    5599 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    5599 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    5599 (MAPK8)
   04660 T cell receptor signaling pathway
    5599 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    5599 (MAPK8)
   04659 Th17 cell differentiation
    5599 (MAPK8)
   04657 IL-17 signaling pathway
    5599 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    5599 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5599 (MAPK8)
   04920 Adipocytokine signaling pathway
    5599 (MAPK8)
   04912 GnRH signaling pathway
    5599 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    5599 (MAPK8)
   04917 Prolactin signaling pathway
    5599 (MAPK8)
   04926 Relaxin signaling pathway
    5599 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    5599 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    5599 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    5599 (MAPK8)
   04722 Neurotrophin signaling pathway
    5599 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5599 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5599 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5599 (MAPK8)
   05231 Choline metabolism in cancer
    5599 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5599 (MAPK8)
   05212 Pancreatic cancer
    5599 (MAPK8)
  09164 Neurodegenerative disease
   05016 Huntington disease
    5599 (MAPK8)
   05017 Spinocerebellar ataxia
    5599 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5599 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5599 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5599 (MAPK8)
   04931 Insulin resistance
    5599 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5599 (MAPK8)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5599 (MAPK8)
   05130 Pathogenic Escherichia coli infection
    5599 (MAPK8)
   05132 Salmonella infection
    5599 (MAPK8)
   05131 Shigellosis
    5599 (MAPK8)
   05135 Yersinia infection
    5599 (MAPK8)
   05133 Pertussis
    5599 (MAPK8)
   05152 Tuberculosis
    5599 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5599 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    5599 (MAPK8)
   05162 Measles
    5599 (MAPK8)
   05161 Hepatitis B
    5599 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5599 (MAPK8)
   05169 Epstein-Barr virus infection
    5599 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5599 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    5599 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5599 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5599 (MAPK8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5599 (MAPK8)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5599 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 5599
NCBI-ProteinID: NP_001265476
OMIM: 601158
HGNC: 6881
Ensembl: ENSG00000107643
Vega: OTTHUMG00000018172
Pharos: P45983(Tchem)
UniProt: P45983 A1L4K2
LinkDB All DBs
Structure
PDB: 

Position
10q11.22
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgattgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttatgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcatcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcagcagct
gggcctctgggctgctgtagatga

KEGG   Homo sapiens (human): 5601Help
Entry
5601              CDS       T01001                                 

Gene name
MAPK9, JNK-55, JNK2, JNK2A, JNK2ALPHA, JNK2B, JNK2BETA, PRKM9, SAPK, SAPK1a, p54a, p54aSAPK
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00930  Escherichia NleD to TNF-JNK signaling pathway
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5601 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5601 (MAPK9)
   04010 MAPK signaling pathway
    5601 (MAPK9)
   04012 ErbB signaling pathway
    5601 (MAPK9)
   04310 Wnt signaling pathway
    5601 (MAPK9)
   04668 TNF signaling pathway
    5601 (MAPK9)
   04068 FoxO signaling pathway
    5601 (MAPK9)
   04071 Sphingolipid signaling pathway
    5601 (MAPK9)
   04024 cAMP signaling pathway
    5601 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5601 (MAPK9)
   04137 Mitophagy - animal
    5601 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    5601 (MAPK9)
   04215 Apoptosis - multiple species
    5601 (MAPK9)
   04217 Necroptosis
    5601 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5601 (MAPK9)
   04530 Tight junction
    5601 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5601 (MAPK9)
   04621 NOD-like receptor signaling pathway
    5601 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    5601 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    5601 (MAPK9)
   04660 T cell receptor signaling pathway
    5601 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    5601 (MAPK9)
   04659 Th17 cell differentiation
    5601 (MAPK9)
   04657 IL-17 signaling pathway
    5601 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    5601 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5601 (MAPK9)
   04920 Adipocytokine signaling pathway
    5601 (MAPK9)
   04912 GnRH signaling pathway
    5601 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    5601 (MAPK9)
   04917 Prolactin signaling pathway
    5601 (MAPK9)
   04926 Relaxin signaling pathway
    5601 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    5601 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    5601 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    5601 (MAPK9)
   04722 Neurotrophin signaling pathway
    5601 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5601 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5601 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5601 (MAPK9)
   05231 Choline metabolism in cancer
    5601 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5601 (MAPK9)
   05212 Pancreatic cancer
    5601 (MAPK9)
  09164 Neurodegenerative disease
   05016 Huntington disease
    5601 (MAPK9)
   05017 Spinocerebellar ataxia
    5601 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5601 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5601 (MAPK9)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5601 (MAPK9)
   04931 Insulin resistance
    5601 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5601 (MAPK9)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5601 (MAPK9)
   05130 Pathogenic Escherichia coli infection
    5601 (MAPK9)
   05132 Salmonella infection
    5601 (MAPK9)
   05131 Shigellosis
    5601 (MAPK9)
   05135 Yersinia infection
    5601 (MAPK9)
   05133 Pertussis
    5601 (MAPK9)
   05152 Tuberculosis
    5601 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5601 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    5601 (MAPK9)
   05162 Measles
    5601 (MAPK9)
   05161 Hepatitis B
    5601 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5601 (MAPK9)
   05169 Epstein-Barr virus infection
    5601 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5601 (MAPK9)
   05142 Chagas disease (American trypanosomiasis)
    5601 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5601 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5601 (MAPK9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5601 (MAPK9)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5601 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5601
NCBI-ProteinID: NP_002743
OMIM: 602896
HGNC: 6886
Ensembl: ENSG00000050748
Vega: OTTHUMG00000130934
Pharos: P45984(Tchem)
UniProt: P45984
LinkDB All DBs
Structure
PDB: 

Position
5q35.3
AA seq 424 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagtaaatgtgacagtcagttttatagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc
atgatgaccccttacgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgaccccgccgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatcgatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggctgtcgatga

KEGG   Homo sapiens (human): 5602Help
Entry
5602              CDS       T01001                                 

Gene name
MAPK10, JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
nt06263  Hepatocellular carcinoma
  Element
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00930  Escherichia NleD to TNF-JNK signaling pathway
Disease
H01813  Lennox-Gastaut syndrome
Drug target
Tanzisertib: D10168
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5602 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5602 (MAPK10)
   04010 MAPK signaling pathway
    5602 (MAPK10)
   04012 ErbB signaling pathway
    5602 (MAPK10)
   04310 Wnt signaling pathway
    5602 (MAPK10)
   04668 TNF signaling pathway
    5602 (MAPK10)
   04068 FoxO signaling pathway
    5602 (MAPK10)
   04071 Sphingolipid signaling pathway
    5602 (MAPK10)
   04024 cAMP signaling pathway
    5602 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5602 (MAPK10)
   04137 Mitophagy - animal
    5602 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    5602 (MAPK10)
   04215 Apoptosis - multiple species
    5602 (MAPK10)
   04217 Necroptosis
    5602 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5602 (MAPK10)
   04530 Tight junction
    5602 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5602 (MAPK10)
   04621 NOD-like receptor signaling pathway
    5602 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    5602 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    5602 (MAPK10)
   04660 T cell receptor signaling pathway
    5602 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    5602 (MAPK10)
   04659 Th17 cell differentiation
    5602 (MAPK10)
   04657 IL-17 signaling pathway
    5602 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    5602 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    5602 (MAPK10)
   04920 Adipocytokine signaling pathway
    5602 (MAPK10)
   04912 GnRH signaling pathway
    5602 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    5602 (MAPK10)
   04917 Prolactin signaling pathway
    5602 (MAPK10)
   04926 Relaxin signaling pathway
    5602 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    5602 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    5602 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    5602 (MAPK10)
   04722 Neurotrophin signaling pathway
    5602 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5602 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5602 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5602 (MAPK10)
   05231 Choline metabolism in cancer
    5602 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5602 (MAPK10)
   05212 Pancreatic cancer
    5602 (MAPK10)
  09164 Neurodegenerative disease
   05016 Huntington disease
    5602 (MAPK10)
   05017 Spinocerebellar ataxia
    5602 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5602 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    5602 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    5602 (MAPK10)
   04931 Insulin resistance
    5602 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5602 (MAPK10)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5602 (MAPK10)
   05130 Pathogenic Escherichia coli infection
    5602 (MAPK10)
   05132 Salmonella infection
    5602 (MAPK10)
   05131 Shigellosis
    5602 (MAPK10)
   05135 Yersinia infection
    5602 (MAPK10)
   05133 Pertussis
    5602 (MAPK10)
   05152 Tuberculosis
    5602 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5602 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    5602 (MAPK10)
   05162 Measles
    5602 (MAPK10)
   05161 Hepatitis B
    5602 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5602 (MAPK10)
   05169 Epstein-Barr virus infection
    5602 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5602 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    5602 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5602 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5602 (MAPK10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     5602 (MAPK10)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   5602 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5602
NCBI-ProteinID: NP_001304996
OMIM: 602897
HGNC: 6872
Ensembl: ENSG00000109339
Vega: OTTHUMG00000130604
Pharos: P53779(Tchem)
UniProt: P53779 A0A286YF97
LinkDB All DBs
Structure
PDB: 

Position
4q21.3
AA seq 464 aa AA seqDB search
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDMWSVGCIMGEMIKGAVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaagcacctc
cattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatgggctac
aaggagaacgttgacatgtggtcagtagggtgcatcatgggagaaatgataaaaggtgca
gtgctgtttcctggcactgatcatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system