KEGG   Homo sapiens (human): 56
Entry
56                CDS       T01001                                 

Gene name
ACRV1, D11S4365, SP-10, SPACA2
Definition
(RefSeq) acrosomal vesicle protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Activin_recp CTC1
Other DBs
NCBI-GeneID: 56
NCBI-ProteinID: NP_001603
OMIM: 102525
HGNC: 127
Ensembl: ENSG00000134940
Vega: OTTHUMG00000165854
Pharos: P26436(Tbio)
UniProt: P26436
LinkDB
Position
11q24.2
AA seq 265 aa
MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSS
GLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPS
GEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPIS
STSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCP
SMNLFSHGTRMQIICCRNQSFCNKI
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaacaggtttctcttgctaatgagtctttatctgcttggatctgccagaggaacatca
agtcagcctaatgagctttctggctccatagatcatcaaacttcagttcagcaacttcca
ggtgagttcttttcacttgaaaacccttctgatgctgaggctttatatgagacttcttca
ggcctgaacactttaagtgagcatggttccagtgagcatggttcaagcaagcacactgtg
gccgagcacacttctggagaacatgctgagagtgagcatgcttcaggtgagcccgctgcg
actgaacatgctgaaggtgagcatactgtaggtgagcagccttcaggagaacagccttca
ggtgaacacctctccggagaacagcctttgagtgagcttgagtcaggtgaacagccttca
gatgaacagccttcaggtgaacatggctccggtgaacagccttctggtgagcaggcctcg
ggtgaacagccttcaggtgagcacgcttcaggggaacaggcttcaggtgcaccaatttca
agcacatctacaggcacaatattaaattgctacacatgtgcttatatgaatgatcaagga
aaatgtcttcgtggagagggaacctgcatcactcagaattcccagcagtgcatgttaaag
aagatctttgaaggtggaaaactccaattcatggttcaagggtgtgagaacatgtgccca
tctatgaacctcttctcccatggaacgaggatgcaaattatatgctgtcgaaatcaatct
ttctgcaataagatctag

DBGET integrated database retrieval system