KEGG   Homo sapiens (human): 5606
Entry
5606              CDS       T01001                                 

Gene name
MAP2K3, MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5606 (MAP2K3)
   04015 Rap1 signaling pathway
    5606 (MAP2K3)
   04668 TNF signaling pathway
    5606 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5606 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5606 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    5606 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5606 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    5606 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5606 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    5606 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5606 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5606 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    5606 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5606 (MAP2K3)
   05135 Yersinia infection
    5606 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5606 (MAP2K3)
   05161 Hepatitis B
    5606 (MAP2K3)
   05169 Epstein-Barr virus infection
    5606 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5606 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5606 (MAP2K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5606 (MAP2K3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   5606 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 5606
NCBI-ProteinID: NP_659731
OMIM: 602315
HGNC: 6843
Ensembl: ENSG00000034152
Vega: OTTHUMG00000134322
Pharos: P46734(Tchem)
UniProt: P46734 Q6FI23
LinkDB
Position
17p11.2
AA seq 347 aa
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgcctcgagccagcccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctacggatatcctgcatgtccaagccacccgcacccaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gctgatgacttggtgaccatctcagaactgggccgtggagcctatggggtggtagagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcggatccgggccaccgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgactgt
ttctacactgtcaccttctacggggcactattcagagagggagacgtgtggatctgcatg
gagctcatggacacatccttggacaagttctaccggaaggtgctggataaaaacatgaca
attccagaggacatccttggggagattgctgtgtctatcgtgcgggccctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtccttatcaacaag
gagggccatgtgaagatgtgtgactttggcatcagtggctacttggtggactctgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccagagctg
aaccagaagggctacaatgtcaagtccgacgtctggagcctgggcatcaccatgattgag
atggccatcctgcggttcccttacgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccccagctcccagccgaccgtttctcccccgagtttgtggac
ttcactgctcagtgcctgaggaagaaccccgcagagcgtatgagctacctggagctgatg
gagcaccccttcttcaccttgcacaaaaccaagaagacggacattgctgccttcgtgaag
gagatcctgggagaagactcatag

KEGG   Homo sapiens (human): 5608
Entry
5608              CDS       T01001                                 

Gene name
MAP2K6, MAPKK6, MEK6, MKK6, PRKMK6, SAPKK-3, SAPKK3
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06263  Hepatocellular carcinoma
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5608 (MAP2K6)
   04015 Rap1 signaling pathway
    5608 (MAP2K6)
   04668 TNF signaling pathway
    5608 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5608 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5608 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    5608 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5608 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    5608 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5608 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5608 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5608 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5608 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    5608 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5608 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5608 (MAP2K6)
   05135 Yersinia infection
    5608 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5608 (MAP2K6)
   05161 Hepatitis B
    5608 (MAP2K6)
   05163 Human cytomegalovirus infection
    5608 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5608 (MAP2K6)
   05169 Epstein-Barr virus infection
    5608 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    5608 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5608 (MAP2K6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5608 (MAP2K6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   5608 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 5608
NCBI-ProteinID: NP_002749
OMIM: 601254
HGNC: 6846
Ensembl: ENSG00000108984
Vega: OTTHUMG00000180311
Pharos: P52564(Tchem)
UniProt: P52564 A8K3Y2
LinkDB
Structure
PDB: 
3FME 3ENM 3VN9

Position
17q24.3
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gaacaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctggagcctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggca
gtgaagcggatccgagccacagtaaatagccaggaacagaaacggctactgatggatttg
gatatttccatgaggacggtggactgtccattcactgtcaccttttatggcgcactgttt
cgggagggtgatgtgtggatctgcatggagctcatggatacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacatagtaagctgtctgtcattcacagagacgtc
aagccttctaatgtactcatcaatgctctcggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgttgctaaaacaattgatgcaggttgcaaaccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacgatgattgagttggccatccttcgatttccctatgattcatgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatcgccacaactcccagca
gacaagttctctgcagagtttgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
ggaacagatgtggcatcttttgtaaaactgattcttggagactaa

KEGG   Homo sapiens (human): 6416
Entry
6416              CDS       T01001                                 

Gene name
MAP2K4, JNKK, JNKK1, MAPKK4, MEK4, MKK4, PRKMK4, SAPKK-1, SAPKK1, SEK1, SERK1, SKK1
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04912  GnRH signaling pathway
hsa04926  Relaxin signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6416 (MAP2K4)
   04012 ErbB signaling pathway
    6416 (MAP2K4)
   04668 TNF signaling pathway
    6416 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6416 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    6416 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6416 (MAP2K4)
   04926 Relaxin signaling pathway
    6416 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    6416 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6416 (MAP2K4)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6416 (MAP2K4)
   05132 Salmonella infection
    6416 (MAP2K4)
   05135 Yersinia infection
    6416 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6416 (MAP2K4)
   05161 Hepatitis B
    6416 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6416 (MAP2K4)
   05169 Epstein-Barr virus infection
    6416 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6416 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6416 (MAP2K4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     6416 (MAP2K4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   6416 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 6416
NCBI-ProteinID: NP_003001
OMIM: 601335
HGNC: 6844
Ensembl: ENSG00000065559
Vega: OTTHUMG00000178267
Pharos: P45985(Tchem)
UniProt: P45985
LinkDB
Structure
PDB: 
3ALN 3ALO 3VUT

Position
17p12
AA seq 399 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
cccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacacagc
attgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaa
gaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacagaagt
ggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctattgccaag
acaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgcatca
cgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgagttg
gccacaggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtc
gtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccgagtttc
atcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagag
cttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system