KEGG   Homo sapiens (human): 5610Help
Entry
5610              CDS       T01001                                 

Gene name
EIF2AK2, EIF2AK1, PKR, PPP1R83, PRKR
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04217  Necroptosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06122  IFN signaling (viruses)
nt06138  PKR-eIF2alpha signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00571  PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00696  MV C to PKR-eIF2alpha signaling pathway
N00725  IAV NS1 to PKR-eIF2alpha signaling pathway
N00726  IAV NP to PKR-eIF2alpha signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5610 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5610 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    5610 (EIF2AK2)
  09172 Infectious disease: viral
   05162 Measles
    5610 (EIF2AK2)
   05164 Influenza A
    5610 (EIF2AK2)
   05160 Hepatitis C
    5610 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    5610 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5610 (EIF2AK2)
   05169 Epstein-Barr virus infection
    5610 (EIF2AK2)
   05165 Human papillomavirus infection
    5610 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5610 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5610 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5610 (EIF2AK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5610 (EIF2AK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   5610 (EIF2AK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5610 (EIF2AK2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     5610 (EIF2AK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr dsrm Kinase-like Kdo DND1_DSRM Pkinase_fungal FTA2
Motif
Other DBs
NCBI-GeneID: 5610
NCBI-ProteinID: NP_001129123
OMIM: 176871
HGNC: 9437
Ensembl: ENSG00000055332
Vega: OTTHUMG00000100962
Pharos: P19525(Tbio)
UniProt: P19525 Q8IW76
LinkDB All DBs
Structure
PDB: 

Position
2p22.2
AA seq 551 aa AA seqDB search
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgatctttcagcaggtttcttcatggaggaacttaatacataccgtcagaag
cagggagtagtacttaaatatcaagaactgcctaattcaggacctccacatgataggagg
tttacatttcaagttataatagatggaagagaatttccagaaggtgaaggtagatcaaag
aaggaagcaaaaaatgccgcagccaaattagctgttgagatacttaataaggaaaagaag
gcagttagtcctttattattgacaacaacgaattcttcagaaggattatccatggggaat
tacataggccttatcaatagaattgcccagaagaaaagactaactgtaaattatgaacag
tgtgcatcgggggtgcatgggccagaaggatttcattataaatgcaaaatgggacagaaa
gaatatagtattggtacaggttctactaaacaggaagcaaaacaattggccgctaaactt
gcatatcttcagatattatcagaagaaacctcagtgaaatctgactacctgtcctctggt
tcttttgctactacgtgtgagtcccaaagcaactctttagtgaccagcacactcgcttct
gaatcatcatctgaaggtgacttctcagcagatacatcagagataaattctaacagtgac
agtttaaacagttcttcgttgcttatgaatggtctcagaaataatcaaaggaaggcaaaa
agatctttggcacccagatttgaccttcctgacatgaaagaaacaaagtatactgtggac
aagaggtttggcatggattttaaagaaatagaattaattggctcaggtggatttggccaa
gttttcaaagcaaaacacagaattgacggaaagacttacgttattaaacgtgttaaatat
aataacgagaaggcggagcgtgaagtaaaagcattggcaaaacttgatcatgtaaatatt
gttcactacaatggctgttgggatggatttgattatgatcctgagaccagtgatgattct
cttgagagcagtgattatgatcctgagaacagcaaaaatagttcaaggtcaaagactaag
tgccttttcatccaaatggaattctgtgataaagggaccttggaacaatggattgaaaaa
agaagaggcgagaaactagacaaagttttggctttggaactctttgaacaaataacaaaa
ggggtggattatatacattcaaaaaaattaattcatagagatcttaagccaagtaatata
ttcttagtagatacaaaacaagtaaagattggagactttggacttgtaacatctctgaaa
aatgatggaaagcgaacaaggagtaagggaactttgcgatacatgagcccagaacagatt
tcttcgcaagactatggaaaggaagtggacctctacgctttggggctaattcttgctgaa
cttcttcatgtatgtgacactgcttttgaaacatcaaagtttttcacagacctacgggat
ggcatcatctcagatatatttgataaaaaagaaaaaactcttctacagaaattactctca
aagaaacctgaggatcgacctaacacatctgaaatactaaggaccttgactgtgtggaag
aaaagcccagagaaaaatgaacgacacacatgttag

KEGG   Homo sapiens (human): 8638Help
Entry
8638              CDS       T01001                                 

Gene name
OASL, OASL1, OASLd, TRIP-14, TRIP14, p59_OASL, p59-OASL, p59OASL
Definition
(RefSeq) 2'-5'-oligoadenylate synthetase like
  KO
K14608  2'-5'-oligoadenylate synthase-like protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
Network
nt06122  IFN signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8638 (OASL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C ubiquitin Rad60-SLD SCAN PAH
Motif
Other DBs
NCBI-GeneID: 8638
NCBI-ProteinID: NP_003724
OMIM: 603281
HGNC: 8090
Ensembl: ENSG00000135114
Vega: OTTHUMG00000154981
Pharos: Q15646(Tbio)
UniProt: Q15646
LinkDB All DBs
Structure
PDB: 

Position
12q24.31
AA seq 514 aa AA seqDB search
MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVR
VLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLD
LGLEDLRMEQRVPDALVFTIQTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKA
CGGPGNFCPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVKARSPRANLPPLYALELLT
IYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKYYTLHNAIIEDCVRKQLKKER
PIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRARDIHLTVEQ
RGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQG
QVLQDWLGLGIYGIQDSDTLILSKKKGEALFPAS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcactgatgcaggaactgtatagcacaccagcctccaggctggactccttcgtggct
cagtggctgcagccccaccgggagtggaaggaagaggtgctagacgctgtgcggaccgtg
gaggagtttctgaggcaggagcatttccaggggaagcgtgggctggaccaggatgtgcgg
gtgctgaaggtagtcaaggtgggctccttcgggaatggcacggttctcaggagcaccaga
gaggtggagctggtggcgtttctgagctgtttccacagcttccaggaggcagccaagcat
cacaaagatgttctgaggctgatatggaaaaccatgtggcaaagccaggacctgctggac
ctcgggctcgaggacctgaggatggagcagagagtccccgatgctctcgtcttcaccatc
cagaccagggggactgcggagcccatcacggtcaccattgtgcctgcctacagagccctg
gggccttctcttcccaactcccagccaccccctgaggtctatgtgagcctgatcaaggcc
tgcggtggtcctggaaatttctgcccatccttcagcgagctgcagagaaatttcgtgaaa
catcggccaactaagctgaagagcctcctgcgcctggtgaaacactggtaccagcagtat
gtgaaagccaggtcccccagagccaatctgccccctctctatgctcttgaacttctaacc
atctatgcctgggaaatgggtactgaagaagacgagaatttcatgttggacgaaggcttc
accactgtgatggacctgctcctggagtatgaagtcatctgtatctactggaccaagtac
tacacactccacaatgcaatcattgaggattgtgtcagaaaacagctcaaaaaagagagg
cccatcatcctggatccggccgaccccaccctcaacgtggcagaagggtacagatgggac
atcgttgctcagagggcctcccagtgcctgaaacaggactgttgctatgacaacagggag
aaccccatctccagctggaacgtgaagagggcacgagacatccacttgacagtggagcag
aggggttacccagatttcaacctcatcgtgaacccttatgagcccataaggaaggttaaa
gagaaaatccggaggaccaggggctactctggcctgcagcgtctgtccttccaggttcct
ggcagtgagaggcagcttctcagcagcaggtgctccttagccaaatatgggatcttctcc
cacactcacatctatctgctggagaccatcccctccgagatccaggtcttcgtgaagaat
cctgatggtgggagctacgcctatgccatcaaccccaacagcttcatcctgggtctgaag
cagcagattgaagaccagcaggggcttcctaaaaagcagcagcagctggaattccaaggc
caagtcctgcaggactggttgggtctggggatctatggcatccaagacagtgacactctc
atcctctcgaagaagaaaggagaggctctgtttccagccagttag

KEGG   Homo sapiens (human): 4599Help
Entry
4599              CDS       T01001                                 

Gene name
MX1, IFI-78K, IFI78, MX, MxA, lncMX1-215
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
Network
nt06122  IFN signaling (viruses)
nt06163  Hepatitis C virus (HCV)
nt06166  Human papillomavirus (HPV)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4599 (MX1)
   05164 Influenza A
    4599 (MX1)
   05160 Hepatitis C
    4599 (MX1)
   05165 Human papillomavirus infection
    4599 (MX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 DUF2120 AAA_29 AAA_16 Ago_PAZ ABC_tran PP_kinase_N
Motif
Other DBs
NCBI-GeneID: 4599
NCBI-ProteinID: NP_001138397
OMIM: 147150
HGNC: 7532
Ensembl: ENSG00000157601
Vega: OTTHUMG00000086755
Pharos: P20591(Tbio)
UniProt: P20591
LinkDB All DBs
Structure
PDB: 

Position
21q22.3
AA seq 662 aa AA seqDB search
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttccgaagtggacatcgcaaaagctgatccagctgctgcatcccaccctcta
ttactgaatggagatgctactgtggcccagaaaaatccaggctcggtggctgagaacaac
ctgtgcagccagtatgaggagaaggtgcgcccctgcatcgacctcattgactccctgcgg
gctctaggtgtggagcaggacctggccctgccagccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgttggaggcactgtcaggagttgcccttcccagaggcagcggg
atcgtgaccagatgcccgctggtgctgaaactgaagaaacttgtgaacgaagataagtgg
agaggcaaggtcagttaccaggactacgagattgagatttcggatgcttcagaggtagaa
aaggaaattaataaagcccagaatgccatcgccggggaaggaatgggaatcagtcatgag
ctaatcaccctggagatcagctcccgagatgtcccggatctgactctaatagaccttcct
ggcataaccagagtggctgtgggcaatcagcctgctgacattgggtataagatcaagaca
ctcatcaagaagtacatccagaggcaggagacaatcagcctggtggtggtccccagtaat
gtggacatcgccaccacagaggctctcagcatggcccaggaggtggaccccgagggagac
aggaccatcggaatcttgacgaagcctgatctggtggacaaaggaactgaagacaaggtt
gtggacgtggtgcggaacctcgtgttccacctgaagaagggttacatgattgtcaagtgc
cggggccagcaggagatccaggaccagctgagcctgtccgaagccctgcagagagagaag
atcttctttgagaaccacccatatttcagggatctgctggaggaaggaaaggccacggtt
ccctgcctggcagaaaaacttaccagcgagctcatcacacatatctgtaaatctctgccc
ctgttagaaaatcaaatcaaggagactcaccagagaataacagaggagctacaaaagtat
ggtgtcgacataccggaagacgaaaatgaaaaaatgttcttcctgatagataaagttaat
gcctttaatcaggacatcactgctctcatgcaaggagaggaaactgtaggggaggaagac
attcggctgtttaccagactccgacacgagttccacaaatggagtacaataattgaaaac
aattttcaagaaggccataaaattttgagtagaaaaatccagaaatttgaaaatcagtat
cgtggtagagagctgccaggctttgtgaattacaggacatttgagacaatcgtgaaacag
caaatcaaggcactggaagagccggctgtggatatgctacacaccgtgacggatatggtc
cggcttgctttcacagatgtttcgataaaaaattttgaagagttttttaacctccacaga
accgccaagtccaaaattgaagacattagagcagaacaagagagagaaggtgagaagctg
atccgcctccacttccagatggaacagattgtctactgccaggaccaggtatacaggggt
gcattgcagaaggtcagagagaaggagctggaagaagaaaagaagaagaaatcctgggat
tttggggctttccagtccagctcggcaacagactcttccatggaggagatctttcagcac
ctgatggcctatcaccaggaggccagcaagcgcatctccagccacatccctttgatcatc
cagttcttcatgctccagacgtacggccagcagcttcagaaggccatgctgcagctcctg
caggacaaggacacctacagctggctcctgaaggagcggagcgacaccagcgacaagcgg
aagttcctgaaggagcggcttgcacggctgacgcaggctcggcgccggcttgcccagttc
cccggttaa

KEGG   Homo sapiens (human): 9636Help
Entry
9636              CDS       T01001                                 

Gene name
ISG15, G1P2, IFI15, IMD38, IP17, UCRP, hUCRP
Definition
(RefSeq) ISG15 ubiquitin like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
  Element
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    9636 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    9636 (ISG15)
   05165 Human papillomavirus infection
    9636 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9636 (ISG15)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9636 (ISG15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 9636
NCBI-ProteinID: NP_005092
OMIM: 147571
HGNC: 4053
Ensembl: ENSG00000187608
Vega: OTTHUMG00000040777
Pharos: P05161(Tbio)
UniProt: P05161
LinkDB All DBs
Structure
PDB: 

Position
1p36.33
AA seq 165 aa AA seqDB search
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc
agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc
ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt
gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa
cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg
acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac
ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac
ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag
cctggcgggcggagctaa

DBGET integrated database retrieval system