KEGG   Homo sapiens (human): 5613Help
Entry
5613              CDS       T01001                                 

Gene name
PRKX, PKX1
Definition
(RefSeq) protein kinase X-linked
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5613 (PRKX)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  PKA family
   5613 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5613
NCBI-ProteinID: NP_005035
OMIM: 300083
HGNC: 9441
Ensembl: ENSG00000183943
Vega: OTTHUMG00000021087
Pharos: P51817(Tchem)
UniProt: P51817 A0A024RBU5
LinkDB All DBs
Position
Xp22.33
AA seq 358 aa AA seqDB search
MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTF
GRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDER
FLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILL
DRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG
FPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHH
RWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcccgggctggcccaggcggccgcggcggagagcgactcccgcaaggtggcg
gaggagacccccgacggggcgcccgcgctctgccccagccctgaggcgctgtcgccggag
ccgcctgtgtacagcctgcaggactttgacacgctggccaccgtgggcactgggacgttc
gggcgggtgcacctggtgaaggagaagacagccaagcatttcttcgccctcaaggtgatg
agcattcccgacgtcatccgcctaaagcaggagcaacacgtacacaatgagaagtctgtc
ctgaaggaagtcagccacccgttcctcatcaggctgttctggacgtggcatgacgagcgc
ttcctctacatgctcatggagtacgtgccgggcggcgagctcttcagctacctgcgcaac
cgggggcgcttctccagcaccacggggctcttctactctgcagagatcatctgtgccatc
gagtacctgcactccaaagagatcgtctacagggacttgaagccagagaacatcctgctg
gatagggatggccacattaagctcacggactttgggttcgccaagaagctggtagacagg
acttggaccctctgtggaacacccgagtacctagcccccgaagtcattcagagcaagggc
cacggaagggccgtggactggtgggccctcggcatcctgatattcgagatgctttcgggg
tttcctccgttttttgatgacaacccgtttggcatttatcagaaaattcttgcaggcaaa
atagatttccccagacatttggatttccatgtaaaagacctcattaagaaactgctcgtg
gttgacagaacaaggcgattaggaaacatgaagaacggggcgaatgatgtgaagcatcat
cggtggttccgctccgtggactgggaagctgttccgcagagaaaactgaagcctcccatc
gtgcccaagatagctggtgacggcgacacttccaacttcgaaacttaccctgagaatgac
tgggacacagccgcgcccgtgccgcagaaggatttagaaatcttcaagaatttctga

DBGET integrated database retrieval system