KEGG   Homo sapiens (human): 5621
Entry
5621              CDS       T01001                                 

Gene name
PRNP, ASCR, AltPrP, CD230, CJD, GSS, KURU, PRIP, PrP, PrP27-30, PrP33-35C, PrPc, p27-30
Definition
(RefSeq) prion protein
  KO
K05634  prion protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06412  Unfolded protein response (UPR) signaling
nt06415  PI3K signaling
nt06419  Microtubule-based transport
nt06420  Ubiquitin-proteasome system
nt06465  Prion disease
  Element
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
N01198  Scrapie conformation PrPSc to PERK-ATF4 signaling pathway
N01199  Scrapie conformation PrPSc to mGluR5-Ca2+ -apoptotic pathway
N01200  Scrapie conformation PrPSc to transport of calcium
N01201  Scrapie conformation PrPSc to VGCC-Ca2+ -apoptotic pathway
N01202  Oligomeric conformation PrPc to anterograde axonal transport
N01203  Scrapie conformation PrPSc to Notch singling pathway
N01204  PRNP-PI3K-NOX2 signaling pathway
N01205  Scrapie conformation PrPSc to PRNP-PI3K-NOX2 signaling pathway
Disease
H00061  Prion disease
H01243  Huntington disease-like syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    5621 (PRNP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    5621 (PRNP)
   05022 Pathways of neurodegeneration - multiple diseases
    5621 (PRNP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5621 (PRNP)
   04090 CD molecules [BR:hsa04090]
    5621 (PRNP)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5621 (PRNP)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    5621 (PRNP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5621 (PRNP)
CD molecules [BR:hsa04090]
 Proteins
  5621 (PRNP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Others
   5621 (PRNP)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  5621 (PRNP)
SSDB
Motif
Pfam: Prion Prion_bPrPp Pectate_lyase_3
Other DBs
NCBI-GeneID: 5621
NCBI-ProteinID: NP_000302
OMIM: 176640
HGNC: 9449
Ensembl: ENSG00000171867
Vega: OTTHUMG00000031786
Pharos: P04156(Tchem)
UniProt: P04156 Q53YK7
LinkDB
Structure
PDB: 

Position
20p13
AA seq 253 aa
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcgaaccttggctgctggatgctggttctctttgtggccacatggagtgacctgggc
ctctgcaagaagcgcccgaagcctggaggatggaacactgggggcagccgatacccgggg
cagggcagccctggaggcaaccgctacccacctcagggcggtggtggctgggggcagcct
catggtggtggctgggggcagcctcatggtggtggctgggggcagccccatggtggtggc
tggggacagcctcatggtggtggctggggtcaaggaggtggcacccacagtcagtggaac
aagccgagtaagccaaaaaccaacatgaagcacatggctggtgctgcagcagctggggca
gtggtggggggccttggcggctacatgctgggaagtgccatgagcaggcccatcatacat
ttcggcagtgactatgaggaccgttactatcgtgaaaacatgcaccgttaccccaaccaa
gtgtactacaggcccatggatgagtacagcaaccagaacaactttgtgcacgactgcgtc
aatatcacaatcaagcagcacacggtcaccacaaccaccaagggggagaacttcaccgag
accgacgttaagatgatggagcgcgtggttgagcagatgtgtatcacccagtacgagagg
gaatctcaggcctattaccagagaggatcgagcatggtcctcttctcctctccacctgtg
atcctcctgatctctttcctcatcttcctgatagtgggatga

DBGET integrated database retrieval system