KEGG   Homo sapiens (human): 5644
Entry
5644              CDS       T01001                                 

Gene name
PRSS1, TRP1, TRY1, TRY4, TRYP1
Definition
(RefSeq) serine protease 1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Disease
H00933  Hereditary pancreatitis
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5644 (PRSS1)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5644 (PRSS1)
   04974 Protein digestion and absorption
    5644 (PRSS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5644 (PRSS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5644 (PRSS1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5644 (PRSS1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5644 (PRSS1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5644 (PRSS1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5644 (PRSS1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 5644
NCBI-ProteinID: NP_002760
OMIM: 276000
HGNC: 9475
Ensembl: ENSG00000204983
Vega: OTTHUMG00000158923
Pharos: P07477(Tclin)
UniProt: P07477
LinkDB
Structure
PDB: 
2RA3 4WWY 4WXV 1FXY 1TRN

Position
7q34
AA seq 247 aa
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatccactcctgatccttacctttgtggcagctgctcttgctgccccctttgatgat
gatgacaagatcgttgggggctacaactgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgtggtggctccctcatcaacgaacagtgggtggtatca
gcaggccactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgagcagttcatcaatgcagccaagatcatccgccacccccaatacgac
aggaagactctgaacaatgacatcatgttaatcaagctctcctcacgtgcagtaatcaac
gcccgcgtgtccaccatctctctgcccaccgcccctccagccactggcacgaagtgcctc
atctctggctggggcaacactgcgagctctggcgccgactacccagacgagctgcagtgc
ctggatgctcctgtgctgagccaggctaagtgtgaagcctcctaccctggaaagattacc
agcaacatgttctgtgtgggcttccttgagggaggcaaggattcatgtcagggtgattct
ggtggccctgtggtctgcaatggacagctccaaggagttgtctcctggggtgatggctgt
gcccagaagaacaagcctggagtctacaccaaggtctacaactatgtgaaatggattaag
aacaccatagctgccaatagctaa

KEGG   Homo sapiens (human): 5645
Entry
5645              CDS       T01001                                 

Gene name
PRSS2, TRY2, TRY8, TRYP2
Definition
(RefSeq) serine protease 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Disease
H00933  Hereditary pancreatitis
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5645 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5645 (PRSS2)
   04974 Protein digestion and absorption
    5645 (PRSS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5645 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5645 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5645 (PRSS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5645 (PRSS2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5645 (PRSS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5645 (PRSS2)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 5645
NCBI-ProteinID: NP_002761
OMIM: 601564
HGNC: 9483
Ensembl: ENSG00000275896
Vega: OTTHUMG00000158904
Pharos: P07478(Tchem)
UniProt: P07478 Q5NV56 Q6PK75
LinkDB
Position
7q34
AA seq 247 aa
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatctacttctgatccttacctttgttgcagctgctgttgctgccccctttgatgat
gatgacaagatcgttgggggctacatctgtgaggagaattctgtcccctaccaggtgtcc
ttgaattctggctaccacttctgcggtggctccctcatcagcgaacagtgggtggtgtca
gcaggtcactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgaacagttcatcaatgcggccaagatcatccgccaccccaaatacaac
agccggactctggacaatgacatcctgctgatcaagctctcctcacctgccgtcatcaat
tcccgcgtgtccgccatctctctgcccactgcccctccagctgctggcaccgagtccctc
atctccggctggggcaacactctgagttctggtgccgactacccagacgagctgcagtgc
ctggatgctcctgtgctgagccaggctgagtgtgaagcctcctaccctggaaagattacc
aacaacatgttctgtgtgggcttcctcgagggaggcaaggattcctgccagggtgattct
ggtggccctgtggtctccaatggagagctccaaggaattgtctcctggggctatggctgt
gcccagaagaacaggcctggagtctacaccaaggtctacaactatgtggactggattaag
gacaccatagctgccaacagctaa

KEGG   Homo sapiens (human): 5646
Entry
5646              CDS       T01001                                 

Gene name
PRSS3, MTG, PRSS4, T9, TRY3, TRY4
Definition
(RefSeq) serine protease 3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5646 (PRSS3)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5646 (PRSS3)
   04974 Protein digestion and absorption
    5646 (PRSS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5646 (PRSS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5646 (PRSS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5646 (PRSS3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5646 (PRSS3)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5646 (PRSS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5646 (PRSS3)
SSDB
Motif
Pfam: Trypsin
Other DBs
NCBI-GeneID: 5646
NCBI-ProteinID: NP_031369
OMIM: 613578
HGNC: 9486
Ensembl: ENSG00000010438
Vega: OTTHUMG00000019798
Pharos: P35030(Tchem)
UniProt: P35030
LinkDB
Structure
PDB: 

Position
9p13.3
AA seq 139 aa
MLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQ
AECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGV
YTKVYNYVDWIKDTIAANS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgctgatcaaactctcctcacctgccgtcatcaatgcccgcgtgtccaccatctctctg
cccaccacccctccagctgctggcactgagtgcctcatctccggctggggcaacactctg
agctttggtgctgactacccagacgagctgaagtgcctggatgctccggtgctgacccag
gctgagtgtaaagcctcctaccctggaaagattaccaacagcatgttctgtgtgggcttc
cttgagggaggcaaggattcctgccagcgtgactctggtggccctgtggtctgcaacgga
cagctccaaggagttgtctcctggggccatggctgtgcctggaagaacaggcctggagtc
tacaccaaggtctacaactatgtggactggattaaggacaccatcgctgccaacagctaa

DBGET integrated database retrieval system