KEGG   Homo sapiens (human): 5646
Entry
5646              CDS       T01001                                 

Gene name
PRSS3, MTG, PRSS4, T9, TRY3, TRY4
Definition
(RefSeq) serine protease 3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5646 (PRSS3)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5646 (PRSS3)
   04974 Protein digestion and absorption
    5646 (PRSS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5646 (PRSS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5646 (PRSS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5646 (PRSS3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5646 (PRSS3)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5646 (PRSS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5646 (PRSS3)
SSDB
Motif
Pfam: Trypsin
Other DBs
NCBI-GeneID: 5646
NCBI-ProteinID: NP_001184026
OMIM: 613578
HGNC: 9486
Ensembl: ENSG00000010438
Vega: OTTHUMG00000019798
Pharos: P35030(Tchem)
UniProt: P35030
LinkDB
Structure
PDB: 

Position
9p13.3
AA seq 261 aa
MHMRETSGFTLKKGRSAPLVFHPPDALIAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSH
FCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDN
DIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVL
TQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRP
GVYTKVYNYVDWIKDTIAANS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcacatgagagagacaagtggcttcacattgaagaaggggaggagtgcgccattggtt
ttccatcctccagatgcactgattgctgtcccctttgacgatgatgacaagattgttggg
ggctacacctgtgaggagaattctctcccctaccaggtgtccctgaattctggctcccac
ttctgcggtggctccctcatcagcgaacagtgggtggtatcagcagctcactgctacaag
acccgcatccaggtgagactgggagagcacaacatcaaagtcctggaggggaatgagcag
ttcatcaatgcggccaagatcatccgccaccctaaatacaacagggacactctggacaat
gacatcatgctgatcaaactctcctcacctgccgtcatcaatgcccgcgtgtccaccatc
tctctgcccaccacccctccagctgctggcactgagtgcctcatctccggctggggcaac
actctgagctttggtgctgactacccagacgagctgaagtgcctggatgctccggtgctg
acccaggctgagtgtaaagcctcctaccctggaaagattaccaacagcatgttctgtgtg
ggcttccttgagggaggcaaggattcctgccagcgtgactctggtggccctgtggtctgc
aacggacagctccaaggagttgtctcctggggccatggctgtgcctggaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattaaggacaccatcgctgccaac
agctaa

DBGET integrated database retrieval system