KEGG   Homo sapiens (human): 5654
Entry
5654              CDS       T01001                                 

Gene name
HTRA1, ARMD7, CADASIL2, CARASIL, HtrA, L56, ORF480, PRSS11
Definition
(RefSeq) HtrA serine peptidase 1
  KO
K08784  HtrA serine peptidase 1 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Disease
H00821  Age-related macular degeneration
H01757  Cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5654 (HTRA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5654 (HTRA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5654 (HTRA1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5654 (HTRA1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  DegP / HtrA
   5654 (HTRA1)
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ IGFBP PDZ_2 Kazal_2 Peptidase_S46 Kazal_1 Peptidase_S32 LSM
Other DBs
NCBI-GeneID: 5654
NCBI-ProteinID: NP_002766
OMIM: 602194
HGNC: 9476
Ensembl: ENSG00000166033
Vega: OTTHUMG00000019186
Pharos: Q92743(Tbio)
UniProt: Q92743
LinkDB
Structure
PDB: 

Position
10q26.13
AA seq 480 aa
MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARD
ACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG
SDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA
PAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEA
KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT
QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI
KKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgcagatcccgcgcgccgctcttctcccgctgctgctgctgctgctggcggcgcccgcc
tcggcgcagctgtcccgggccggccgctcggcgcctttggccgccgggtgcccagaccgc
tgcgagccggcgcgctgcccgccgcagccggagcactgcgagggcggccgggcccgggac
gcgtgcggctgctgcgaggtgtgcggcgcgcccgagggcgccgcgtgcggcctgcaggag
ggcccgtgcggcgaggggctgcagtgcgtggtgcccttcggggtgccagcctcggccacg
gtgcggcggcgcgcgcaggccggcctctgtgtgtgcgccagcagcgagccggtgtgcggc
agcgacgccaacacctacgccaacctgtgccagctgcgcgccgccagccgccgctccgag
aggctgcaccggccgccggtcatcgtcctgcagcgcggagcctgcggccaagggcaggaa
gatcccaacagtttgcgccataaatataactttatcgcggacgtggtggagaagatcgcc
cctgccgtggttcatatcgaattgtttcgcaagcttccgttttctaaacgagaggtgccg
gtggctagtgggtctgggtttattgtgtcggaagatggactgatcgtgacaaatgcccac
gtggtgaccaacaagcaccgggtcaaagttgagctgaagaacggtgccacttacgaagcc
aaaatcaaggatgtggatgagaaagcagacatcgcactcatcaaaattgaccaccagggc
aagctgcctgtcctgctgcttggccgctcctcagagctgcggccgggagagttcgtggtc
gccatcggaagcccgttttcccttcaaaacacagtcaccaccgggatcgtgagcaccacc
cagcgaggcggcaaagagctggggctccgcaactcagacatggactacatccagaccgac
gccatcatcaactatggaaactcgggaggcccgttagtaaacctggacggtgaagtgatt
ggaattaacactttgaaagtgacagctggaatctcctttgcaatcccatctgataagatt
aaaaagttcctcacggagtcccatgaccgacaggccaaaggaaaagccatcaccaagaag
aagtatattggtatccgaatgatgtcactcacgtccagcaaagccaaagagctgaaggac
cggcaccgggacttcccagacgtgatctcaggagcgtatataattgaagtaattcctgat
accccagcagaagctggtggtctcaaggaaaacgacgtcataatcagcatcaatggacag
tccgtggtctccgccaatgatgtcagcgacgtcattaaaagggaaagcaccctgaacatg
gtggtccgcaggggtaatgaagatatcatgatcacagtgattcccgaagaaattgaccca
tag

DBGET integrated database retrieval system