KEGG   Homo sapiens (human): 5660Help
Entry
5660              CDS       T01001                                 

Gene name
PSAP, GLBA, SAP1
Definition
(RefSeq) prosaposin
  KO
K12382  saposin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Disease
H00126  Gaucher disease
H00127  Metachromatic leukodystrophy (MLD)
H00135  Krabbe disease
H00423  Defects in the degradation of sulfatide
H00426  Defects in the degradation of ganglioside
H01239  Combined SAP deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    5660 (PSAP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5660 (PSAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SapB_1 SapB_2 SapA TLE_N Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 5660
NCBI-ProteinID: NP_002769
OMIM: 176801
HGNC: 9498
Ensembl: ENSG00000197746
Vega: OTTHUMG00000018429
Pharos: P07602(Tbio)
UniProt: P07602 A0A024QZQ2
LinkDB All DBs
Structure
PDB: 

Position
10q22.1
AA seq 524 aa AA seqDB search
MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKS
LPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDI
IKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLY
PQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADI
CKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVE
PIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEV
VDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLD
RNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIG
ACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccctcttcctcctggccagcctcctgggcgcggctctagccggcccggtcctt
ggactgaaagaatgcaccaggggctcggcagtgtggtgccagaatgtgaagacggcgtcc
gactgcggggcagtgaagcactgcctgcagaccgtttggaacaagccaacagtgaaatcc
cttccctgcgacatatgcaaagacgttgtcaccgcagctggtgatatgctgaaggacaat
gccactgaggaggagatccttgtttacttggagaagacctgtgactggcttccgaaaccg
aacatgtctgcttcatgcaaggagatagtggactcctacctccctgtcatcctggacatc
attaaaggagaaatgagccgtcctggggaggtgtgctctgctctcaacctctgcgagtct
ctccagaagcacctagcagagctgaatcaccagaagcagctggagtccaataagatccca
gagctggacatgactgaggtggtggcccccttcatggccaacatccctctcctcctctac
cctcaggacggcccccgcagcaagccccagccaaaggataatggggacgtttgccaggac
tgcattcagatggtgactgacatccagactgctgtacggaccaactccacctttgtccag
gccttggtggaacatgtcaaggaggagtgtgaccgcctgggccctggcatggccgacata
tgcaagaactatatcagccagtattctgaaattgctatccagatgatgatgcacatgcaa
cccaaggagatctgtgcgctggttgggttctgtgatgaggtgaaagagatgcccatgcag
actctggtccccgccaaagtggcctccaagaatgtcatccctgccctggaactggtggag
cccattaagaagcacgaggtcccagcaaagtctgatgtttactgtgaggtgtgtgaattc
ctggtgaaggaggtgaccaagctgattgacaacaacaagactgagaaagaaatactcgac
gcttttgacaaaatgtgctcgaagctgccgaagtccctgtcggaagagtgccaggaggtg
gtggacacgtacggcagctccatcctgtccatcctgctggaggaggtcagccctgagctg
gtgtgcagcatgctgcacctctgctctggcacgcggctgcctgcactgaccgttcacgtg
actcagccaaaggacggtggcttctgcgaagtgtgcaagaagctggtgggttatttggat
cgcaacctggagaaaaacagcaccaagcaggagatcctggctgctcttgagaaaggctgc
agcttcctgccagacccttaccagaagcagtgtgatcagtttgtggcagagtacgagccc
gtgctgatcgagatcctggtggaggtgatggatccttccttcgtgtgcttgaaaattgga
gcctgcccctcggcccataagcccttgttgggaactgagaagtgtatatggggcccaagc
tactggtgccagaacacagagacagcagcccagtgcaatgctgtcgagcattgcaaacgc
catgtgtggaactag

DBGET integrated database retrieval system