KEGG   Homo sapiens (human): 56894Help
Entry
56894             CDS       T01001                                 

Gene name
AGPAT3, 1-AGPAT_3, LPAAT-GAMMA1, LPAAT3
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase 3
  KO
K13523  lysophosphatidic acid acyltransferase / lysophosphatidylinositol acyltransferase [EC:2.3.1.51 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    56894 (AGPAT3)
   00564 Glycerophospholipid metabolism
    56894 (AGPAT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    56894 (AGPAT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    56894 (AGPAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     56894 (AGPAT3)
    2.3.1.-  
     56894 (AGPAT3)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   56894 (AGPAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransf_C Acyltransferase
Motif
Other DBs
NCBI-GeneID: 56894
NCBI-ProteinID: NP_001032642
OMIM: 614794
HGNC: 326
Ensembl: ENSG00000160216
Vega: OTTHUMG00000086892
Pharos: Q9NRZ7(Tbio)
UniProt: Q9NRZ7
LinkDB All DBs
Position
21q22.3
AA seq 376 aa AA seqDB search
MGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQ
LVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKV
LAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRF
TETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSL
LGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPGEQFK
PARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTE
IEKGSSYGNQEFKKKE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgctggccttcctgaagacccagttcgtgctgcacctgctggtcggctttgtc
ttcgtggtgagtggtctggtcatcaacttcgtccagctgtgcacgctggcgctctggccg
gtcagcaagcagctctaccgccgcctcaactgccgcctcgcctactcactctggagccaa
ctggtcatgctgctggagtggtggtcctgcacggagtgtacactgttcacggaccaggcc
acggtagagcgctttgggaaggagcacgcagtcatcatcctcaaccacaacttcgagatc
gacttcctctgtgggtggaccatgtgtgagcgcttcggagtgctggggagctccaaggtc
ctcgctaagaaggagctgctctacgtgcccctcatcggctggacgtggtactttctggag
attgtgttctgcaagcggaagtgggaggaggaccgggacaccgtggtcgaagggctgagg
cgcctgtcggactaccccgagtacatgtggtttctcctgtactgcgaggggacgcgcttc
acggagaccaagcaccgcgttagcatggaggtggcggctgctaaggggcttcctgtcctc
aagtaccacctgctgccgcggaccaagggcttcaccaccgcagtcaagtgcctccggggg
acagtcgcagctgtctatgatgtaaccctgaacttcagaggaaacaagaacccgtccctg
ctggggatcctctacgggaagaagtacgaggcggacatgtgcgtgaggagatttcctctg
gaagacatcccgctggatgaaaaggaagcagctcagtggcttcataaactgtaccaggag
aaggacgcgctccaggagatatataatcagaagggcatgtttccaggggagcagtttaag
cctgcccggaggccgtggaccctcctgaacttcctgtcctgggccaccattctcctgtct
cccctcttcagttttgtcttgggcgtctttgccagcggatcacctctcctgatcctgact
ttcttggggtttgtgggagcagcttcctttggagttcgcagactgataggagtaactgag
atagaaaaaggctccagctacggaaaccaagagtttaagaaaaaggaataa

DBGET integrated database retrieval system