KEGG   Homo sapiens (human): 56917
Entry
56917             CDS       T01001                                 

Gene name
MEIS3, MRG2
Definition
(RefSeq) Meis homeobox 3
  KO
K16671  homeobox protein Meis3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    56917 (MEIS3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    56917 (MEIS3)
SSDB
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Other DBs
NCBI-GeneID: 56917
NCBI-ProteinID: NP_001287988
HGNC: 29537
Ensembl: ENSG00000105419
Vega: OTTHUMG00000172280
Pharos: Q99687(Tbio)
UniProt: Q99687 A0A024R0W2 Q49A38
LinkDB
Position
19q13.32
AA seq 375 aa
MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEI
YGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSER
PLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDG
GCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGL
DTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQ
DTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPG
SVGMSLNLEGEWHYL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcccggaggtatgatgagctgccgcactacccaggcatcgtggatggccccgcagcc
ctggctagcttcccagagacagtgcccgcagtaccagggccctatggcccgcaccggcct
ccccagcccctgcccccaggcttggacagcgacggcctgaagagggagaaggatgagatc
tatggacacccgctcttccccctcttggccctggtctttgagaaatgtgaactggctaca
tgctctccccgtgacggggccggagctgggctggggacaccccctggaggtgacgtctgc
tcctctgattccttcaacgaggacatcgctgcctttgccaagcaggttcgctctgagagg
cccctcttctcctccaacccagaactggacaatctgatgatccaggccatccaggtgctg
cggttccacctgctggagctggagaaggtccacgacctgtgcgacaacttctgtcaccgc
tacatcacctgcctcaagggaaagatgcccatcgacctggtcatcgaggatcgggacggc
ggctgcagggaggacttcgaggactacccagcctcctgccccagcctcccagaccagaat
aatatgtggattcgagaccatgaggatagtgggtctgtacatttggggaccccaggtcca
tccagtgggggcctggcctcccagagtggggacaactccagtgaccaaggagacgggctg
gacaccagcgtggcctctcccagttctggtggagaagatgaggacttggaccaggagcga
cggcgaaacaagaagagggggatcttccccaaggtggccaccaacatcatgcgagcctgg
ttgttccagcacctctcgcacccgtacccctcggaggagcagaagaaacagctggcgcag
gacacggggctcaccatcctgcaagtcaacaactggttcattaacgcccggagacgcatc
gtgcaacctatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagag
ggccagcccatcgggggctataccgagacgcagccacacgtggccgtccggcctccggga
tcagtggggatgagtttgaacttggaaggagaatggcattatctatag

DBGET integrated database retrieval system