KEGG   Homo sapiens (human): 56924Help
Entry
56924             CDS       T01001                                 

Gene name
PAK6, PAK5
Definition
(RefSeq) p21 (RAC1) activated kinase 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04660  T cell receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05170  Human immunodeficiency virus 1 infection
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    56924 (PAK6)
   04012 ErbB signaling pathway
    56924 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    56924 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    56924 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    56924 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    56924 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    56924 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    56924 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    56924 (PAK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56924 (PAK6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   56924 (PAK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 56924
NCBI-ProteinID: NP_001263646
OMIM: 608110
HGNC: 16061
Ensembl: ENSG00000137843
Vega: OTTHUMG00000129921
Pharos: Q9NQU5(Tchem)
UniProt: Q9NQU5 A0A024R9Q4
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 681 aa AA seqDB search
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTGTNRHGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagcgccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcgatgcctgtggatggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagcccccagtctgagcgcactgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgagtttcagggtgcctcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacgggcaccaataggcatggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccgggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacagcccctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcctctttccgaccgccgcagaaagacaacccccca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcggataccagcagcccccagaagtccctccgcacagccccggccacaggc
cagcttccaggccggtcttccccagcgggatccccccgcacctggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggtgccctggctggtgag
gacacaggtgttgtgacacatgagcagttcaaggctgcgctcaggatggtggtggaccag
ggtgacccccggctgctgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgcttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgag
gagcagattgccactgtgtgtgaggctgtgctgcaggccctggcctacctgcatgctcag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctcgatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtagatggggagccaccg
tacttcagtgactccccagtgcaagccatgaagaggctccgggacagccccccacccaag
ctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctacctgagtgcctggtgcccctgatccagctctaccgaaagcagacctccacc
tgctga

DBGET integrated database retrieval system