KEGG   Homo sapiens (human): 56999
Entry
56999             CDS       T01001                                 

Gene name
ADAMTS9
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 9
  KO
K08624  a disintegrin and metalloproteinase with thrombospondin motifs 9 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    56999 (ADAMTS9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     56999 (ADAMTS9)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   56999 (ADAMTS9)
SSDB
Motif
Pfam: TSP1_ADAMTS GON TSP_1 Pep_M12B_propep ADAM_spacer1 TSP1_spondin Reprolysin ADAM_CR_2 TSP1_CCN Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M78
Other DBs
NCBI-GeneID: 56999
NCBI-ProteinID: NP_891550
OMIM: 605421
HGNC: 13202
Ensembl: ENSG00000163638
Vega: OTTHUMG00000158722
Pharos: Q9P2N4(Tbio)
UniProt: Q9P2N4
LinkDB
Position
3p14.1
AA seq 1935 aa
MQFVSWATLLTLLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLSEYEIVSPIRVNALG
EPFPTNVHFKRTRRSINSATDPWPAFASSSSSSTSSQAHYRLSAFGQQFLFNLTANAGFI
APLFTVTLLGTPGVNQTKFYSEEEAELKHCFYKGYVNTNSEHTAVISLCSGMLGTFRSHD
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTR
ARKWGERINLAGDVAALNSGLATEAFSAYGNKTDNTREKRTHRRTKRFLSYPRFVEVLVV
ADNRMVSYHGENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIVIHNEQDGPSISFNA
QTTLKNFCQWQHSKNSPGGIHHDTAVLLTRQDICRAHDKCDTLGLAELGTICDPYRSCSI
SEDSGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWMWSKCSR
KYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVCPYMMQCRR
LWCNNVNGVHKGCRTQHTPWADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTC
SRTCGGGIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFRDEQCAHFDGK
HFNINGLLPNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGQDTNDICV
QGLCRQAGCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATNID
VRQHSFSGETDDDNYLALSSSKGEFLLNGNFVVTMAKREIRIGNAVVEYSGSETAVERIN
STDRIEQELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKR
KLVCTRESDQLTVSDQRCDRLPQPGHITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDI
YCAKYSRLDGKTEKVDDGFCSSHPKPSNREKCSGECNTGGWRYSAWTECSKSCDGGTQRR
RAICVNTRNDVLDDSKCTHQEKVTIQRCSEFPCPQWKSGDWSECLVTCGKGHKHRQVWCQ
FGEDRLNDRMCDPETKPTSMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYM
SVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGK
GTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTCGQGRAT
RQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSAS
PSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACES
GPCPQWAYGNWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACP
HDAAWSTGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPK
WKAGAWSQCSVSCGRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWR
AEEWQECTKTCGEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGE
WSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSAT
WRVGNWGSCSVSCGVGVMQRSVQCLTNEDQPSHLCHTDLKPEERKTCRNVYNCELPQNCK
EVKRLKGASEDGEYFLMIRGKLLKIFCAGMHSDHPKEYVTLVHGDSENFSEVYGHRLHNP
TECPYNGSRRDDCQCRKDYTAAGFSSFQKIRIDLTSMQIITTDLQFARTSEGHPVPFATA
GDCYSAAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVVGKCGGYCG
KCTPSSGTGLEVRVL
NT seq 5808 nt   +upstreamnt  +downstreamnt
atgcagtttgtatcctgggccacactgctaacgctcctggtgcgggacctggccgagatg
gggagcccagacgccgcggcggccgtgcgcaaggacaggctgcacccgaggcaagtgaaa
ttattagagaccctgagcgaatacgaaatcgtgtctcccatccgagtgaacgctctcgga
gaaccctttcccacgaacgtccacttcaaaagaacgcgacggagcattaactctgccact
gacccctggcctgccttcgcctcctcctcttcctcctctacctcctcccaggcgcattac
cgcctctctgccttcggccagcagtttctatttaatctcaccgccaatgccggatttatc
gctccactgttcactgtcaccctcctcgggacgcccggggtgaatcagaccaagttttat
tccgaagaggaagcggaactcaagcactgtttctacaaaggctatgtcaataccaactcc
gagcacacggccgtcatcagcctctgctcaggaatgctgggcacattccggtctcatgat
ggggattattttattgaaccactacagtctatggatgaacaagaagatgaagaggaacaa
aacaaaccccacatcatttataggcgcagcgccccccagagagagccctcaacaggaagg
catgcatgtgacacctcagaacacaaaaataggcacagtaaagacaagaagaaaaccaga
gcaagaaaatggggagaaaggattaacctggctggtgacgtagcagcattaaacagcggc
ttagcaacagaggcattttctgcttatggtaataagacggacaacacaagagaaaagagg
acccacagaaggacaaaacgttttttatcctatccacggtttgtagaagtcttggtggtg
gcagacaacagaatggtttcataccatggagaaaaccttcaacactatattttaacttta
atgtcaattgtagcctctatctataaagacccaagtattggaaatttaattaatattgtt
attgtgaacttaattgtgattcataatgaacaggatgggccttccatatcttttaatgct
cagacaacattaaaaaacttttgccagtggcagcattcgaagaacagtccaggtggaatc
catcatgatactgctgttctcttaacaagacaggatatctgcagagctcacgacaaatgt
gataccttaggcctggctgaactgggaaccatttgtgatccctatagaagctgttctatt
agtgaagatagtggattgagtacagcttttacgatcgcccatgagctgggccatgtgttt
aacatgcctcatgatgacaacaacaaatgtaaagaagaaggagttaagagtccccagcat
gtcatggctccaacactgaacttctacaccaacccctggatgtggtcaaagtgtagtcga
aaatatatcactgagtttttagacactggttatggcgagtgtttgcttaacgaacctgaa
tccagaccctaccctttgcctgtccaactgccaggcatcctttacaacgtgaataaacaa
tgtgaattgatttttggaccaggttctcaggtgtgcccatatatgatgcagtgcagacgg
ctctggtgcaataacgtcaatggagtacacaaaggctgccggactcagcacacaccctgg
gccgatgggacggagtgcgagcctggaaagcactgcaagtatggattttgtgttcccaaa
gaaatggatgtccccgtgacagatggatcctggggaagttggagtccctttggaacctgc
tccagaacatgtggagggggcatcaaaacagccattcgagagtgcaacagaccagaacca
aaaaatggtggaaaatactgtgtaggacgtagaatgaaatttaagtcctgcaacacggag
ccatgtctcaagcagaagcgagacttccgagatgaacagtgtgctcactttgacgggaag
cattttaacatcaacggtctgcttcccaatgtgcgctgggtccctaaatacagtggaatt
ctgatgaaggaccggtgcaagttgttctgcagagtggcagggaacacagcctactatcag
cttcgagacagagtgatagatggaactccttgtggccaggacacaaatgatatctgtgtc
cagggcctttgccggcaagctggatgcgatcatgttttaaactcaaaagcccggagagat
aaatgtggggtttgtggtggcgataattcttcatgcaaaacagtggcaggaacatttaat
acagtacattatggttacaatactgtggtccgaattccagctggtgctaccaatattgat
gtgcggcagcacagtttctcaggggaaacagacgatgacaactacttagctttatcaagc
agtaaaggtgaattcttgctaaatggaaactttgttgtcacaatggccaaaagggaaatt
cgcattgggaatgctgtggtagagtacagtgggtccgagactgccgtagaaagaattaac
tcaacagatcgcattgagcaagaacttttgcttcaggttttgtcggtgggaaagttgtac
aaccccgatgtacgctattctttcaatattccaattgaagataaacctcagcagttttac
tggaacagtcatgggccatggcaagcatgcagtaaaccctgccaaggggaacggaaacga
aaacttgtttgcaccagggaatctgatcagcttactgtttctgatcaaagatgcgatcgg
ctgccccagcctggacacattactgaaccctgtggtacagactgtgacctgaggtggcat
gttgccagcaggagtgaatgtagtgcccagtgtggcttgggttaccgcacattggacatc
tactgtgccaaatatagcaggctggatgggaagactgagaaggttgatgatggtttttgc
agcagccatcccaaaccaagcaaccgtgaaaaatgctcaggggaatgtaacacgggtggc
tggcgctattctgcctggactgaatgttcaaaaagctgtgacggtgggacccagaggaga
agggctatttgtgtcaatacccgaaatgatgtactggatgacagcaaatgcacacatcaa
gagaaagttaccattcagaggtgcagtgagttcccttgtccacagtggaaatctggagac
tggtcagagtgcttggtcacctgtggaaaagggcataagcaccgccaggtctggtgtcag
tttggtgaagatcgattaaatgatagaatgtgtgaccctgagaccaagccaacatctatg
cagacttgtcagcagccggaatgtgcatcctggcaggcgggtccctggggacagtgcagt
gtcacttgtggacagggataccagctaagagcagtgaaatgcatcattgggacttatatg
tcagtggtagatgacaatgactgtaatgcagcaactagaccaactgatacccaggactgt
gaattaccatcatgtcatcctcccccagctgccccggaaacgaggagaagcacatacagt
gcaccaagaacccagtggcgatttgggtcttggaccccatgctcagccacttgtgggaaa
ggtacccggatgagatacgtcagctgccgagatgagaatggctctgtggctgacgagagt
gcctgtgctaccctgcctagaccagtggcaaaggaagaatgttctgtgacaccctgtggg
caatggaaggccttggactggagctcttgctctgtgacctgtgggcaaggtagggcaacc
cggcaagtgatgtgtgtcaactacagtgaccacgtgatcgatcggagtgagtgtgaccag
gattatatcccagaaactgaccaggactgttccatgtcaccatgccctcaaaggacccca
gacagtggcttagctcagcaccccttccaaaatgaggactatcgtccccggagcgccagc
cccagccgcacccatgtgctcggtggaaaccagtggagaactggcccctggggagcatgt
tccagtacctgtgctggcggatcccagcggcgtgttgttgtatgtcaggatgaaaatgga
tacaccgcaaacgactgtgtggagagaataaaacctgatgagcaaagagcctgtgaatcc
ggcccttgtcctcagtgggcttatggcaactggggagagtgcactaagctgtgtggtgga
ggcataagaacaagactggtggtctgtcagcggtccaacggtgaacggtttccagatttg
agctgtgaaattcttgataaacctcccgatcgtgagcagtgtaacacacatgcttgtcca
cacgacgctgcatggagtactggcccttggagctcgtgttctgtctcttgtggtcgaggg
cataaacaacgaaatgtttactgcatggcaaaagatggaagccatttagaaagtgattac
tgtaagcacctggctaagccacatgggcacagaaagtgccgaggaggaagatgccccaaa
tggaaagctggcgcttggagtcagtgctctgtgtcctgtggccgaggcgtacagcagagg
catgtgggctgtcagatcggaacacacaaaatagccagagagaccgagtgcaacccatac
accagaccggagtcggaacgcgactgccaaggcccacggtgtcccctctacacttggagg
gcagaggaatggcaagaatgcaccaagacctgcggcgaaggctccaggtaccgcaaggtg
gtgtgtgtggatgacaacaaaaacgaggtgcatggggcacgctgtgacgtgagcaagcgg
ccggtggaccgtgaaagctgtagtttgcaaccctgcgagtatgtctggatcacaggagaa
tggtcagagtgctcagtgacctgtggaaaaggctacaaacaaaggcttgtctcgtgcagc
gagatttacaccgggaaggagaattatgaatacagctaccaaaccaccatcaactgccca
ggcacgcagccccccagtgttcacccctgttacctgagggactgccctgtctcggccacc
tggagagttggcaactgggggagctgctcagtgtcttgtggtgttggagtgatgcagaga
tctgtgcaatgtttaaccaatgaggaccaacccagccacttatgccacactgatctgaag
ccagaagaacgaaaaacctgccgtaatgtctataactgtgagttaccccagaattgcaag
gaggtaaaaagacttaaaggtgccagtgaagatggtgaatatttcctgatgattagagga
aagcttctgaagatattctgtgcggggatgcactctgaccaccccaaagagtacgtgaca
ctggtgcatggagactctgagaatttctccgaggtttatgggcacaggttacacaaccca
acagaatgtccctataacgggagccggcgcgatgactgccaatgtcggaaggattacacg
gccgctgggttttccagttttcagaaaatcagaatagacctgaccagcatgcagataatc
accactgacttacagtttgcaaggacaagcgaaggacatcccgtcccttttgccacagcc
ggggattgctacagcgctgccaagtgcccacagggtcgttttagcatcaacctttatgga
accggcttgtctttaactgaatctgccagatggatatcacaagggaattatgctgtctct
gacatcaagaagtcgccggatggtacccgagtcgtagggaaatgcggtggttactgtgga
aaatgcactccatcctctggtactggcctggaggtgcgagttttatag

DBGET integrated database retrieval system