KEGG   Homo sapiens (human): 57101
Entry
57101             CDS       T01001                                 

Gene name
ANO2, C12orf3, TMEM16B
Definition
(RefSeq) anoctamin 2
  KO
K19497  anoctamin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    57101 (ANO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    57101 (ANO2)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   57101 (ANO2)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 57101
NCBI-ProteinID: NP_001265525
OMIM: 610109
HGNC: 1183
Ensembl: ENSG00000047617
Vega: OTTHUMG00000168264
Pharos: Q9NQ90(Tbio)
UniProt: Q9NQ90 F1T0L7
LinkDB
Position
12p13.31
AA seq 1003 aa
MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPC
GGESTRSSSVINNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPG
HSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENK
SQGSIFVRIHAPWQVLAREAEFLKIKVPTKKEMYEIKAGGSIAKKFSAALQKLSSHLQPR
VPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRIVHEILKRTACSRANNTMGI
NSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKI
GLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEE
RAQEHSRPEYETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFA
SILFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIY
GAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVF
DGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRKLKDETEAGETD
SAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRL
DAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYW
FILSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKL
MDEPALRSPGGGDRSRSRAASSAPSGQSQLGSMMSSGSQHTNV
NT seq 3012 nt   +upstreamnt  +downstreamnt
atggcgactcccgggccgcgcgatatacccctgctccctggctccccacgccggctgagc
cctcaggcagggtccagagggggccagggccccaaacatggacagcagtgtctcaagatg
ccaggtccccgggccccaggtctgcagggcggttccaacagagatcctggccagccctgc
ggtggagagagcacccgcagcagctctgtcatcaacaactatctggatgccaatgagcct
gtgtccttggaggcccgtcttagccgcatgcacttccatgacagtcagaggaaggtcgac
tatgtacttgcctaccactaccggaaacgcggggtgcacctggcccaaggcttccctggc
cactcgctggctatcgtctccaatggggagacaggcaaggagcctcatgctgggggccca
ggtgacattgagctgggaccgctcgatgccctggaggaggagaggaaggagcagcgggag
gaatttgagcacaatctgatggaggctggactggagcttgagaaggacttggagaataaa
agccagggatccatctttgtccggatacacgccccgtggcaggtgctggccagagaggca
gaattcttgaagatcaaagttcctaccaagaaagagatgtacgagatcaaagcaggaggc
agcattgcaaagaagttcagcgcggctctgcagaagctgagctcgcacctgcagccccga
gttccagaacacagcaacaacaagatgaaaaacctctcctacccattctccagggagaag
atgtacctgtacaacatccaggaaaaggacaccttctttgataatgccacccgcagccgc
attgtgcacgagatcctgaagcgcacagcctgctcccgagccaacaacacgatgggtatt
aactctctgatcgcaaacaatatctatgaggctgcctaccctcttcatgacggtgaatac
gatagtccagaggacgatatgaatgacaggaagctgctatatcaagaatgggcgcgctat
ggagtgttctataagttccaacctattgacctcatcagaaagtattttggagaaaaaatt
ggactgtattttgcctggctgggattatatacatcattcctcatcccatcttctgtaatt
ggagtgattgtgtttctttatggatgtgcaacaattgaagaagatattcccagcagagag
atgtgtgaccagcagaatgccttcaccatgtgtcccctgtgtgacaagtcctgtgattac
tggaacctcagctcagcctgtgggaccgcgcaggccagccacctgtttgacaaccctgcc
accgtcttcttctctatcttcatggctctgtgggctaccatgttcctggaaaactggaag
aggctacagatgcgactgggctacttttgggacctgactggcatagaagaggaagaagaa
cgtgcccaggaacattccaggcctgagtatgaaaccaaagttcgagagaaaatgctaaag
gagagcaaccagtctgctgtccagaaattggaaacaaacacgacggagtgtggcgatgag
gatgatgaagataaactgacctggaaggatcgtttcccaggttacctgatgaactttgcc
tccatcttattcatgattgccctgacattctcaatcgtctttggggtgatagtgtatcga
ataacaactgcagccgctctgtctctcaataaggctacacgctccaatgtccgggtgaca
gtgacagcaacagcagtcatcatcaacctcgtggtcatcctcatcctggacgagatctac
ggcgctgtggccaagtggctcaccaaaattgaggttccgaaaacagaacagacttttgaa
gagcgcctgatcctcaaagctttcttgctcaagtttgtcaatgcctactcccccatcttc
tatgtggcctttttcaaagggaggtttgtgggcaggcctggaagctacgtctatgtattc
gatggttaccgcatggaagagtgtgctccagggggctgtctcatggagctctgcattcag
ctcagcatcatcatgttggggaagcagttgatccagaacaacatctttgagattggagtc
ccgaagctaaagaaactatttcgaaagctgaaagatgagaccgaagctggagaaactgac
tctgcccattcgaaacatccagagcagtgggacctagactacagcttggaaccatacaca
ggactgactccggagtacatggaaatgatcatccagtttggttttgtcaccctcttcgtg
gcctcctttcccctggcacctgtgtttgccctcctcaacaacgtcattgaagtgcggctc
gatgcaaagaagtttgttacagagctgagacggccggatgctgtaagaaccaaagatatc
ggaatctggtttgacattctctctggaattggcaagttctctgttatcagcaacgctttt
gtcattgcgatcacctccgactttatcccccgcctggtgtaccagtactcctacagtcac
aatgggactctgcacggctttgtcaaccacaccctctcctttttcaacgtcagccagctg
aaggaggggacgcagccagaaaactcacagtttgaccaggaggttcagttctgcaggttt
aaggattaccgagagccgccatgggccccgaacccttatgagttttcgaaacagtactgg
tttattctgtccgcccgtctggcttttgtcataatcttccagaacctcgtgatgttcctg
agcgtcctcgtggactggatgattccagacatccccacggacatcagcgaccagatcaag
aaagagaagagcttattagtggatttcttcctgaaagaggagcatgagaagctcaagctg
atggatgagccggctctgaggagcccaggaggtggggatcgaagcaggagccgggcagcc
agctcagcaccttcaggccaaagccagctgggcagcatgatgtcgtcaggctctcagcac
accaatgtgtga

DBGET integrated database retrieval system