KEGG   Homo sapiens (human): 57118Help
Entry
57118             CDS       T01001                                 

Gene name
CAMK1D, CKLiK, CaM-K1, CaMKID
Definition
(RefSeq) calcium/calmodulin dependent protein kinase ID
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa05214  Glioma
Network
nt06220  Calcium signaling
nt06273  Glioma
nt06316  Angiotensin-aldosterone signaling
  Element
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    57118 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    57118 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    57118 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    57118 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    57118 (CAMK1D)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     57118 (CAMK1D)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   57118 (CAMK1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo RIO1 APH 5_nucleotid Tyrosinase
Motif
Other DBs
NCBI-GeneID: 57118
NCBI-ProteinID: NP_705718
OMIM: 607957
HGNC: 19341
Ensembl: ENSG00000183049
Vega: OTTHUMG00000017683
Pharos: Q8IU85(Tchem)
UniProt: Q8IU85 Q5SQQ7
LinkDB All DBs
Structure
PDB: 

Position
10p13
AA seq 385 aa AA seqDB search
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagctgaagacatcaag
aagatcttcgagttcaaagagaccctcggaaccggggccttttccgaagtggttttagct
gaagagaaggcaactggcaagctctttgctgtgaagtgtatccctaagaaggcgctgaag
ggcaaggaaagcagcatagagaatgagatagccgtcctgagaaagattaagcatgaaaat
attgttgccctggaagacatttatgaaagcccaaatcacctgtacttggtcatgcagctg
gtgtccggtggagagctgtttgaccggatagtggagaaggggttttatacagagaaggat
gccagcactctgatccgccaagtcttggacgccgtgtactatctccacagaatgggcatc
gtccacagagacctcaagcccgaaaatctcttgtactacagtcaagatgaggagtccaaa
ataatgatcagtgactttggattgtcaaaaatggagggcaaaggagatgtgatgtccact
gcctgtggaactccaggctatgtcgctcctgaagtcctcgcccagaaaccttacagcaaa
gccgttgactgctggtccatcggagtgattgcctacatcttgctctgcggctaccctcct
ttttatgatgaaaatgactccaagctctttgagcagatcctcaaggcggaatatgagttt
gactctccctactgggatgacatctccgactctgcaaaagacttcattcggaacctgatg
gagaaggacccgaataaaagatacacgtgtgagcaggcagctcggcacccatggatcgct
ggtgacacagccctcaacaaaaacatccacgagtccgtcagcgcccagatccggaaaaac
tttgccaagagcaaatggagacaagcatttaatgccacggccgtcgtcagacatatgaga
aaactacacctcggcagcagcctggacagttcaaatgcaagtgtttcgagcagcctcagt
ttggccagccaaaaagactgtctggcaccttccacgctctgtagtttcatttcttcttcg
tcgggggtctcaggagttggagccgagcggagacccaggcccaccactgtgacggcagtg
cactctggaagcaagtga

DBGET integrated database retrieval system