KEGG   Homo sapiens (human): 5731Help
Entry
5731              CDS       T01001                                 

Gene name
PTGER1, EP1
Definition
(RefSeq) prostaglandin E receptor 1
  KO
K04258  prostaglandin E receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Drug target
Alprostadil (DG00239): D00180 D02705
Ecraprost: D02723
Enisoprost: D03999
Gemeprost: D02073
Limaprost (DG01271): D02722 D02860
Ornoprostil: D01869
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5731 (PTGER1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5731 (PTGER1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5731 (PTGER1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5731 (PTGER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5731 (PTGER1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5731 (PTGER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 5731
NCBI-ProteinID: NP_000946
OMIM: 176802
HGNC: 9593
Ensembl: ENSG00000160951
Vega: OTTHUMG00000039610
Pharos: P34995(Tclin)
UniProt: P34995
LinkDB All DBs
Position
19p13.12
AA seq 402 aa AA seqDB search
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttgcgggcccctcaacctgagcctggcgggcgaggcgaccacatgcgcggcg
ccctgggtccccaacacgtcggccgtgccgccgtcgggcgcttcgcccgcgctgcccatc
ttctccatgacgctgggcgccgtgtccaacctgctggcgctggcgctgctggcgcaggcc
gcgggccgcctgcgacgccgccgctcggccgccaccttcctgctgttcgtggccagcctg
ctggccaccgacctggcgggccacgtgatcccgggcgcgctggtgctgcgtctgtacact
gcggggcgcgctccggccggcggggcctgccacttcctgggcggctgcatggtcttcttc
ggcctgtgcccgctgctgctgggctgtggcatggccgtggagcgctgcgtgggcgtcacg
cggccgctgctccacgccgcgcgggtctcggtcgcccgcgcgcgcctggcgctggccgcg
gtggccgcggtggccttggccgtggcgctgctgccgctggcgcgcgtgggccgctatgag
ctgcagtacccgggcacgtggtgcttcatcggcctgggtcccccgggcggctggcgccag
gcactgcttgctggcctcttcgccagcctcggcctggtcgcgctcctcgccgcgctggtg
tgcaacacgctcagcggcctggccctgctacgcgcccgctggcgacgccgctcccgacgg
cctcccccggcctcaggccccgacagccggcgtcgctggggggcgcacggaccccgctcg
gcctccgcctcgtccgcctcgtccatcgcttcggcctccaccttctttggcggctctcgg
agcagcggctcggcacgcagagctcgcgcccacgacgtggagatggtgggccagcttgtc
ggtatcatggtggtgtcgtgcatctgctggagcccaatgctggtgttggtggcgctggcc
gtcggcggctggagctctacctccctgcagcggccactgttcctggccgtgcgccttgcc
tcctggaaccagatcctggacccttgggtgtacatcctactgcgccaggccgtgctgcgc
caactgcttcgcctcttgcccccgagggccggagccaagggcggccccgcggggctgggc
ctaacaccgagcgcctgggaggccagctcgctgcgcagctcccggcacagcggcctcagc
cacttctaa

KEGG   Homo sapiens (human): 5732Help
Entry
5732              CDS       T01001                                 

Gene name
PTGER2, EP2
Definition
(RefSeq) prostaglandin E receptor 2
  KO
K04259  prostaglandin E receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Disease
H01191  Asthma with nasal polyps and aspirin intolerance
Drug target
Arbaprostil: D02975
Butaprost: D03187
Dinoprostone (DG00448): D00079 D03269
Enprostil: D01891
Evatanepag (DG01894): D09613 D09614
Meteneprost: D02726
Misoprostol: D00419
Omidenepag (DG02831): D10965 D10966
Rioprostil: D05732
Sulprostone: D02725
Taprenepag (DG01895): D09968 D09969
Trimoprostil: D06240
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5732 (PTGER2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5732 (PTGER2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5732 (PTGER2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5732 (PTGER2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5732 (PTGER2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5732 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5732 (PTGER2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5732 (PTGER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Srg DUF412
Motif
Other DBs
NCBI-GeneID: 5732
NCBI-ProteinID: NP_000947
OMIM: 176804
HGNC: 9594
Ensembl: ENSG00000125384
Vega: OTTHUMG00000140300
Pharos: P43116(Tclin)
UniProt: P43116
LinkDB All DBs
Position
14q22.1
AA seq 358 aa AA seqDB search
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcctccaatgactcccagtctgaggactgcgagacgcgacagtggcttccc
ccaggcgaaagcccagccatcagctccgtcatgttctcggccggggtgctggggaacctc
atagcactggcgctgctggcgcgccgctggcggggggacgtggggtgcagcgccggccgc
aggagctccctctccttgttccacgtgctggtgaccgagctggtgttcaccgacctgctc
gggacctgcctcatcagcccagtggtactggcttcgtacgcgcggaaccagaccctggtg
gcactggcgcccgagagccgcgcgtgcacctacttcgctttcgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggccctggagcgctacctctcgatcgggcac
ccctacttctaccagcgccgcgtctcgcgctccgggggcctggccgtgctgcctgtcatc
tatgcagtctccctgctcttctgctcgctgccgctgctggactatgggcagtacgtccag
tactgccccgggacctggtgcttcatccggcacgggcggaccgcttacctgcagctgtac
gccaccctgctgctgcttctcattgtctcggtgctcgcctgcaacttcagtgtcattctc
aacctcatccgcatgcaccgccgaagccggagaagccgctgcggaccttccctgggcagt
ggccggggcggccccggggcccgcaggagaggggaaagggtgtccatggcggaggagacg
gaccacctcattctcctggctatcatgaccatcaccttcgccgtctgctccttgcctttc
acgatttttgcatatatgaatgaaacctcttcccgaaaggaaaaatgggacctccaagct
cttaggtttttatcaattaattcaataattgacccttgggtctttgccatccttaggcct
cctgttctgagactaatgcgttcagtcctctgttgtcggatttcattaagaacacaagat
gcaacacaaacttcctgttctacacagtcagatgccagtaaacaggctgacctttga

KEGG   Homo sapiens (human): 5733Help
Entry
5733              CDS       T01001                                 

Gene name
PTGER3, EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3-VI, EP3e, PGE2-R
Definition
(RefSeq) prostaglandin E receptor 3
  KO
K04260  prostaglandin E receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Drug target
Enprostil: D01891
Misoprostol: D00419
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5733 (PTGER3)
   04024 cAMP signaling pathway
    5733 (PTGER3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5733 (PTGER3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    5733 (PTGER3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5733 (PTGER3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5733 (PTGER3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5733 (PTGER3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5733 (PTGER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 5733
NCBI-ProteinID: NP_001119516
OMIM: 176806
HGNC: 9595
Ensembl: ENSG00000050628
Vega: OTTHUMG00000009399
Pharos: P43115(Tclin)
UniProt: P43115
LinkDB All DBs
Position
1p31.1
AA seq 390 aa AA seqDB search
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagacccggggctacggaggggatgcccccttctgcacccgcctcaaccactcc
tacacaggcatgtgggcgcccgagcgttccgccgaggcgcggggcaacctcacgcgccct
ccagggtctggcgaggattgcggatcggtgtccgtggccttcccgatcaccatgctgctc
actggtttcgtgggcaacgcactggccatgctgctcgtgtcgcgcagctaccggcgccgg
gagagcaagcgcaagaagtccttcctgctgtgcatcggctggctggcgctcaccgacctg
gtcgggcagcttctcaccaccccggtcgtcatcgtcgtgtacctgtccaagcagcgttgg
gagcacatcgacccgtcggggcggctctgcacctttttcgggctgaccatgactgttttc
gggctctcctcgttgttcatcgccagcgccatggccgtcgagcgggcgctggccatcagg
gcgccgcactggtatgcgagccacatgaagacgcgtgccacccgcgctgtgctgctcggc
gtgtggctggccgtgctcgccttcgccctgctgccggtgctgggcgtgggccagtacacc
gtccagtggcccgggacgtggtgcttcatcagcaccgggcgagggggcaacgggactagc
tcttcgcataactggggcaaccttttcttcgcctctgcctttgccttcctggggctcttg
gcgctgacagtcaccttttcctgcaacctggccaccattaaggccctggtgtcccgctgc
cgggccaaggccacggcatctcagtccagtgcccagtggggccgcatcacgaccgagacg
gccattcagcttatggggatcatgtgcgtgctgtcggtctgctggtctccgctcctgata
atgatgttgaaaatgatcttcaatcagacatcagttgagcactgcaagacacacacggag
aagcagaaagaatgcaacttcttcttaatagctgttcgcctggcttcactgaaccagatc
ttggatccttgggtttacctgctgttaagaaagatccttcttcgaaagttttgccagatc
aggtaccacacaaacaactatgcatccagctccacctccttaccctgccagtgttcctca
accttgatgtggagcgaccatttggaaagatga

KEGG   Homo sapiens (human): 5734Help
Entry
5734              CDS       T01001                                 

Gene name
PTGER4, EP4, EP4R
Definition
(RefSeq) prostaglandin E receptor 4
  KO
K04261  prostaglandin E receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
Drug target
Grapiprant: D10638
Misoprostol: D00419
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5734 (PTGER4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5734 (PTGER4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5734 (PTGER4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5734 (PTGER4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5734 (PTGER4)
   05165 Human papillomavirus infection
    5734 (PTGER4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5734 (PTGER4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5734 (PTGER4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL PKS_DE
Motif
Other DBs
NCBI-GeneID: 5734
NCBI-ProteinID: NP_000949
OMIM: 601586
HGNC: 9596
Ensembl: ENSG00000171522
Vega: OTTHUMG00000094769
Pharos: P35408(Tclin)
UniProt: P35408 A0PJF5
LinkDB All DBs
Structure
PDB: 

Position
5p13.1
AA seq 488 aa AA seqDB search
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcccggggtcaattcgtccgcctccttgagccccgaccggctgaacagccca
gtgaccatcccggcggtgatgttcatcttcggggtggtgggcaacctggtggccatcgtg
gtgctgtgcaagtcgcgcaaggagcagaaggagacgaccttctacacgctggtatgtggg
ctggctgtcaccgacctgttgggcactttgttggtgagcccggtgaccatcgccacgtac
atgaagggccaatggcccgggggccagccgctgtgcgagtacagcaccttcattctgctc
ttcttcagcctgtccggcctcagcatcatctgcgccatgagtgtcgagcgctacctggcc
atcaaccatgcctatttctacagccactacgtggacaagcgattggcgggcctcacgctc
tttgcagtctatgcgtccaacgtgctcttttgcgcgctgcccaacatgggtctcggtagc
tcgcggctgcagtacccagacacctggtgcttcatcgactggaccaccaacgtgacggcg
cacgccgcctactcctacatgtacgcgggcttcagctccttcctcattctcgccaccgtc
ctctgcaacgtgcttgtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcaccgagcagcaccacgcggccgcggccgcctcggttgcctcccggggc
caccccgctgcctccccagccttgccgcgcctcagcgactttcggcgccgccggagcttc
cgccgcatcgcgggcgccgagatccagatggtcatcttactcattgccacctccctggtg
gtgctcatctgctccatcccgctcgtggtgcgagtattcgtcaaccagttatatcagcca
agtttggagcgagaagtcagtaaaaatccagatttgcaggccatccgaattgcttctgtg
aaccccatcctagacccctggatatatatcctcctgagaaagacagtgctcagtaaagca
atagagaagatcaaatgcctcttctgccgcattggcgggtcccgcagggagcgctccgga
cagcactgctcagacagtcaaaggacatcttctgccatgtcaggccactctcgctccttc
atctcccgggagctgaaggagatcagcagtacatctcagaccctcctgccagacctctca
ctgccagacctcagtgaaaatggccttggaggcaggaatttgcttccaggtgtgcctggc
atgggcctggcccaggaagacaccacctcactgaggactttgcgaatatcagagacctca
gactcttcacagggtcaggactcagagagtgtcttactggtggatgaggctggtgggagc
ggcagggctgggcctgcccctaaggggagctccctgcaagtcacatttcccagtgaaaca
ctgaacttatcagaaaaatgtatataa

DBGET integrated database retrieval system