KEGG   Homo sapiens (human): 57335Help
Entry
57335             CDS       T01001                                 

Gene name
ZNF286A, ZNF286
Definition
(RefSeq) zinc finger protein 286A
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    57335 (ZNF286A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57335 (ZNF286A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    57335 (ZNF286A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 KRAB Zn-ribbon_8 zf_UBZ zinc_ribbon_15 zf-C2H2_11 HalOD2 C1_4
Motif
Other DBs
NCBI-GeneID: 57335
NCBI-ProteinID: NP_001124314
HGNC: 13501
Ensembl: ENSG00000187607
Vega: OTTHUMG00000166448
Pharos: Q9HBT8(Tdark)
UniProt: Q9HBT8 B2RCD9
LinkDB All DBs
Position
17p12
AA seq 521 aa AA seqDB search
METDLAEMPEKGALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWG
KLDPAQRDVMLENYRNLVSLWLPVSKPESYNLENGKEPLKLERKAPKSSYSDMETRPQSK
DSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALECENWLENQQGNQERHLREMFTHM
NSLSEETDHKHDVYWKSFNQKSVLITEDRVPKGSYAFHTLEKSLKQKSNLMKKQRTYKEK
KPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNECGKSFSHRANLTKHQRTHTRILFEC
SECKKTFTESSSLATHQRIHVGERPYECNECGKGFNRSTHLVQHQLIHTGVKPYECNECD
KAFIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFS
QSTHLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHIGKKPYKCSECGKAFIHSSA
LIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggagacagatttggctgaaatgcctgagaaaggagctctgtcttcccaggattctccc
catttccaagagaagagcacagaagagggagaagtggctgctctgcgcctcacggccaga
tcccaggaaacagtgacattcaaggatgtggccatggactttacaccagaggagtggggg
aagctggatcctgcacaaagggatgtgatgctggagaactataggaacctagtctcactt
tggcttccagtttccaaacctgagagctacaacttggagaatggaaaagaaccattgaag
cttgagagaaaagcccccaaaagcagctattcagacatggagactagaccacagagcaag
gattcaacttcagtgcaagatttttccaaagcagaatcatgcaaagttgcaataatagac
agactgacacggaatagtgtctatgactctaacttggaagcagcccttgaatgtgaaaat
tggttagagaatcagcaaggaaatcaggagagacatttgagagaaatgttcactcacatg
aattcactctctgaggaaacagaccataagcatgatgtatactggaaaagcttcaatcag
aaatctgtccttatcactgaagacagagttcccaaaggatcttatgccttccatacactt
gaaaaaagcttgaaacaaaaatcaaacttaatgaaaaagcagagaacttataaagagaaa
aaacctcataaatgtaatgattgtggtgaactcttcacctaccattcagtgcttattcga
caccagagagtccatactggagagaaaccctatacctgcaatgaatgtgggaaatctttt
agccacagagctaatttaactaaacaccagagaactcatactagaattctctttgaatgc
agtgaatgcaagaaaaccttcacagaaagctcatcccttgcaacacatcagagaattcac
gttggagagagaccttatgaatgcaatgaatgtgggaaaggttttaatcgaagtacacat
cttgtgcagcatcagttgattcatactggagtgaagccttatgaatgtaatgaatgtgat
aaagcttttattcattcatcagcactcattaaacatcaaagaactcatactggagagaaa
ccttataaatgtcaagaatgtgggaaagcctttagccattgctcatccctaactaagcat
cagagagttcatactggagaaaagccatatgaatgcagtgaatgtggaaaaacttttagt
cagagcacacatcttgttcaacatcagagaattcacactggagagaaaccctatgagtgt
aatgaatgtgggaaaaccttcagccggagctccaattttgctaaacatcaaagaattcat
attggaaagaaaccgtacaaatgtagcgagtgtggaaaagccttcattcattcatcagct
ctcattcaacatcagagaactcataccggagagaaaccctttagatgtaatgagtgtggg
aaaagctttaagtgcagttcatctctcatcagacatcaaagagttcacactgaagagcaa
ccctga

DBGET integrated database retrieval system