KEGG   Homo sapiens (human): 5734Help
Entry
5734              CDS       T01001                                 

Gene name
PTGER4, EP4, EP4R
Definition
(RefSeq) prostaglandin E receptor 4
  KO
K04261  prostaglandin E receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
Drug target
Grapiprant: D10638
Misoprostol: D00419
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5734 (PTGER4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5734 (PTGER4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5734 (PTGER4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5734 (PTGER4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5734 (PTGER4)
   05165 Human papillomavirus infection
    5734 (PTGER4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5734 (PTGER4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5734 (PTGER4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL PKS_DE
Motif
Other DBs
NCBI-GeneID: 5734
NCBI-ProteinID: NP_000949
OMIM: 601586
HGNC: 9596
Ensembl: ENSG00000171522
Vega: OTTHUMG00000094769
Pharos: P35408(Tclin)
UniProt: P35408 A0PJF5
LinkDB All DBs
Structure
PDB: 

Position
5p13.1
AA seq 488 aa AA seqDB search
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcccggggtcaattcgtccgcctccttgagccccgaccggctgaacagccca
gtgaccatcccggcggtgatgttcatcttcggggtggtgggcaacctggtggccatcgtg
gtgctgtgcaagtcgcgcaaggagcagaaggagacgaccttctacacgctggtatgtggg
ctggctgtcaccgacctgttgggcactttgttggtgagcccggtgaccatcgccacgtac
atgaagggccaatggcccgggggccagccgctgtgcgagtacagcaccttcattctgctc
ttcttcagcctgtccggcctcagcatcatctgcgccatgagtgtcgagcgctacctggcc
atcaaccatgcctatttctacagccactacgtggacaagcgattggcgggcctcacgctc
tttgcagtctatgcgtccaacgtgctcttttgcgcgctgcccaacatgggtctcggtagc
tcgcggctgcagtacccagacacctggtgcttcatcgactggaccaccaacgtgacggcg
cacgccgcctactcctacatgtacgcgggcttcagctccttcctcattctcgccaccgtc
ctctgcaacgtgcttgtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcaccgagcagcaccacgcggccgcggccgcctcggttgcctcccggggc
caccccgctgcctccccagccttgccgcgcctcagcgactttcggcgccgccggagcttc
cgccgcatcgcgggcgccgagatccagatggtcatcttactcattgccacctccctggtg
gtgctcatctgctccatcccgctcgtggtgcgagtattcgtcaaccagttatatcagcca
agtttggagcgagaagtcagtaaaaatccagatttgcaggccatccgaattgcttctgtg
aaccccatcctagacccctggatatatatcctcctgagaaagacagtgctcagtaaagca
atagagaagatcaaatgcctcttctgccgcattggcgggtcccgcagggagcgctccgga
cagcactgctcagacagtcaaaggacatcttctgccatgtcaggccactctcgctccttc
atctcccgggagctgaaggagatcagcagtacatctcagaccctcctgccagacctctca
ctgccagacctcagtgaaaatggccttggaggcaggaatttgcttccaggtgtgcctggc
atgggcctggcccaggaagacaccacctcactgaggactttgcgaatatcagagacctca
gactcttcacagggtcaggactcagagagtgtcttactggtggatgaggctggtgggagc
ggcagggctgggcctgcccctaaggggagctccctgcaagtcacatttcccagtgaaaca
ctgaacttatcagaaaaatgtatataa

DBGET integrated database retrieval system