KEGG   Homo sapiens (human): 57406
Entry
57406             CDS       T01001                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6, acylglycerol lipase
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    57406 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    57406 (ABHD6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     57406 (ABHD6)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   57406 (ABHD6)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Palm_thioest FSH1 BAAT_C DUF1057 DLH Thioesterase
Other DBs
NCBI-GeneID: 57406
NCBI-ProteinID: NP_001307055
OMIM: 616966
HGNC: 21398
Ensembl: ENSG00000163686
Vega: OTTHUMG00000159150
Pharos: Q9BV23(Tchem)
UniProt: Q9BV23 A0A024R323
LinkDB
Position
3p14.3
AA seq 337 aa
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcggcacgctggccatcccaatc
ctggcatttgtggcttcatttcttctgtggccttcagcactgataagaatctattattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctgggcacaaaccctccatcctcatgctccacggattc
tctgcccacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
gtctgcgtggacatgccaggacatgagggcaccacccgctcctccctggatgacctgtcc
atagatgggcaagttaagaggatacaccagtttgtagaatgcctgaagctgaacaaaaaa
cctttccacctggtaggcacctccatgggtggccaggtggctggggtgtatgctgcttac
tacccatcggatgtctccagcctgtgtctcgtgtgtcctgctggcctgcagtactcaact
gacaatcaatttgtacaacggctcaaagaactgcagggctctgccgccgtggagaagatt
cccttgatcccgtctaccccagaagagatgagtgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggccttgtcgatgtccgcatccctcataac
aacttctaccgaaagttgtttttggaaatcgtcagtgagaagtccagatactctctccat
cagaacatggacaagatcaaggttccgacgcagatcatctgggggaaacaagaccaggtg
ctggatgtgtctggggcagacatgttggccaagtcaattgccaactgccaggtggagctt
ctggaaaactgtgggcactcagtagtgatggaaagacccaggaagacagccaagctcata
atcgactttttagcttctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system