KEGG   Homo sapiens (human): 5743Help
Entry
5743              CDS       T01001                                 

Gene name
PTGS2, COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04064  NF-kappa B signaling pathway
hsa04370  VEGF signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa05140  Leishmaniasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05222  Small cell lung cancer
Network
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
Disease
H00017  Esophageal cancer
H00025  Penile cancer
H00046  Cholangiocarcinoma
Drug target
Aceclofenac: D01545
Acemetacin: D01582
Acetylsalicylic acid (DG00015): D00109 D05181 D07579 D07580 D07581 D07582
Alclofenac: D01252
Alminoprofen: D01513
Aloxiprin: D07421
Amfenac (DG01249): D01788 D07443
Ampiroxicam: D01397
Apricoxib: D08657
Benzydamine (except lozenges) (DG00014): D01410 D07516 D07517
Bromfenac (DG01128): D03163 D07541
Bufexamac: D01271
Carprofen: D03410
Celecoxib: D00567
Choline salicylate: D00810
Darbufelone mesylate: D03652
Deracoxib: D03689
Dexibuprofen (DG00756): D03715 D03718
Dexketoprofen: D07269
Diclofenac (DG00441): D00903 D00904 D07816 D07817 D07818 D07819
Diflunisal: D00130
Droxicam: D07267
Eltenac: D07888
Etodolac: D00315
Etofenamate: D04102
Etoricoxib: D03710
Felbinac (DG00764): D01675 D01841
Fenbufen: D01344
Fenoprofen (DG00754): D00968 D02350
Firocoxib: D03712
Flufenamic acid (DG00757): D01581 D01823 D03254
Flurbiprofen (DG00755): D00330 D01475 D02290 D10254
Glycol salicylate: D01557
Ibuprofen (DG00245): D00126 D01122 D04490 D06606 D08058 D08059 D09760
Ibuproxam: D07268
Indobufen: D07141
Indometacin (DG00241): D00141 D01565 D02110
Ketoprofen (DG00753): D00132 D08102 D08103
Ketorolac (DG00751): D00813 D08104
Lornoxicam: D01866
Loxoprofen (DG01251): D01709 D08149
Lumiracoxib: D03714
Magnesium salicylate: D00827
Mavacoxib: D04863
Meclofenamic acid (DG00758): D00169 D02341 D08162
Mefenamic acid: D00151
Meloxicam: D00969
Nabumetone: D00425
Naproxcinod: D09568
Naproxen (DG00455): D00118 D00970 D10017
Nepafenac: D05143
Niflumic acid: D08275
Nimesulide: D01049
Orpanoxin: D05275
Oxaprozin: D00463
Oxyphenbutazone (DG00746): D05319 D08324
Pamicogrel: D01090
Paracetamol: D00217
Parecoxib (DG00759): D03716 D03717
Phenbutazone sodium glycerate: D05451
Phenylbutazone (DG00745): D00510 D08363 D08364
Piketoprofen (DG01250): D08374 D08375
Piroxicam (DG00752): D00127 D05511 D05512 D05513
Polmacoxib: D10656
Pranoprofen: D01578
Pravadoline maleate: D05598
Proglumetacin (DG00750): D01765 D08427
Propacetamol (DG00828): D07294 D08434
Rofecoxib: D00568
Salicylamide: D01811
Salicylate meglumine: D05791
Salsalate: D00428
Sodium salicylate: D00566
Sulindac: D00120
Tebufelone: D06017
Tenidap (DG00761): D06072 D06073
Tenoxicam: D01767
Tiaprofenic acid: D01325
Tilmacoxib: D01974
Tolfenamic acid: D01183
Tolmetin (DG00747): D00158 D02355
Trolamine: D08501
Valdecoxib: D02709
Zaltoprofen: D01547
Zidometacin: D06364
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    5743 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    5743 (PTGS2)
   04064 NF-kappa B signaling pathway
    5743 (PTGS2)
   04668 TNF signaling pathway
    5743 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    5743 (PTGS2)
   04657 IL-17 signaling pathway
    5743 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    5743 (PTGS2)
   04913 Ovarian steroidogenesis
    5743 (PTGS2)
   04921 Oxytocin signaling pathway
    5743 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    5743 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    5743 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5743 (PTGS2)
   05206 MicroRNAs in cancer
    5743 (PTGS2)
   05204 Chemical carcinogenesis
    5743 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    5743 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    5743 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5743 (PTGS2)
   05165 Human papillomavirus infection
    5743 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    5743 (PTGS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     5743 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 5743
NCBI-ProteinID: NP_000954
OMIM: 600262
HGNC: 9605
Ensembl: ENSG00000073756
Vega: OTTHUMG00000035473
Pharos: P35354(Tclin)
UniProt: P35354
LinkDB All DBs
Structure
PDB: 

Position
1q31.1
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccctgctgctgtgcgcggtcctggcgctcagccatacagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggagaaaactgctcaacaccggaatttttg
acaagaataaaattatttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgctgactat
ggctacaaaagctgggaagccttctctaacctctcctattatactagagcccttcctcct
gtgcctgatgattgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgagattgtggaaaaattgcttctaagaagaaagttcatccctgatccccagggctca
aacatgatgtttgcattctttgcccagcacttcacgcatcagtttttcaagacagatcat
aagcgagggccagctttcaccaacgggctgggccatggggtggacttaaatcatatttac
ggtgaaactctggctagacagcgtaaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcctgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcaacacttgagtggc
tatcacttcaaactgaaatttgacccagaactacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgaatttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaaatacaactatcaacagtttatctacaacaactctatattg
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacccgcagtacagaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcggcca
gatgccatctttggtgaaaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgcctactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttacttcattcagtgttccagatccagagctcattaaaacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactaaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system