KEGG   Homo sapiens (human): 57449Help
Entry
57449             CDS       T01001                                 

Gene name
PLEKHG5, CMTRIC, DSMA4, GEF720, Syx, Tech
Definition
(RefSeq) pleckstrin homology and RhoGEF domain containing G5
  KO
K19464  pleckstrin homology domain-containing family G member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
Disease
H00264  Charcot-Marie-Tooth disease
H00856  Distal hereditary motor neuropathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    57449 (PLEKHG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF UNC-79 PH_10 PH_5 PH_13 PH_16 IQ_SEC7_PH
Motif
Other DBs
NCBI-GeneID: 57449
NCBI-ProteinID: NP_001036128
OMIM: 611101
HGNC: 29105
Ensembl: ENSG00000171680
Vega: OTTHUMG00000000905
Pharos: O94827(Tbio)
UniProt: O94827
LinkDB All DBs
Position
1p36.31
AA seq 1062 aa AA seqDB search
MDDQSPAEKKGLRCQNPACMDKGRAAKVCHHADCQQLHRRGPLNLCEACDSKFHSTMHYD
GHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEEESSVDGKGDRKSTGLKLSKKKA
RRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQ
SNTPLSLTFEAYRFGGHYLRVKAPAKPGDEGKVEQGMKDSKSLSLPILRPAGTGPPALER
VDAQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPTPSSCSLPSGSSGSTNTGDSWKN
RAASRFSGFFSSGPSTSAFGREVDKMEQLEGKLHTYSLFGLPRLPRGLRFDHDSWEEEYD
EDEDEDNACLRLEDSWRELIDGHEKLTRRQCHQQEAVWELLHTEASYIRKLRVIINLFLC
CLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKG
FKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKP
HQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSR
IDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVY
CFLFTDLLLVTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTF
QASGQALCRGWVDTIYNAQNQLQQLRAQEPPGSQQPLQSLEEEEDEQEEEEEEEEEEEEG
EDSGTSAASSPTIMRKSSGSPDSQHCASDGSTETLAMVVVEPGDTLSSPEFDSGPFSSQS
DETSLSTTASSATPTSELLPLGPVDGRSCSMDSAYGTLSPTSLQDFVAPGPMAELVPRAP
ESPRVPSPPPSPRLRRRTPVQLLSCPPHLLKSKSEASLLQLLAGAGTHGTPSAPSRSLSE
LCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGA
SPRVQPEPPPGVSAQHRKLTLAQLYRIRTTLLLNSTLTASEV
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccagagccccgctgaaaagaagggactgcgctgtcagaaccccgcctgcatg
gacaaggggcgggcggccaaggtatgtcaccacgccgactgccagcagctgcaccgccgg
gggcccctcaacctctgcgaggcctgtgacagcaagttccacagcaccatgcattatgat
gggcatgtccgcttcgaccttcccccacaaggctctgtgctggcccggaacgtgtccacc
cggtcatgcccgccgcgcaccagccccgcagtggacttggaggaggaggaggaggagagc
tctgtggatggcaaaggggaccggaagagcacaggcctgaaactctccaagaagaaagca
aggaggagacacacggatgacccaagcaaggaatgcttcactctgaaatttgacctgaat
gtggacattgagacagagatcgtcccagccatgaagaagaagtcactgggggaggtgctg
ctgcctgtatttgaaaggaagggcattgcgctgggcaaagtggacatctacctggaccag
tccaacacacccctgtccctcaccttcgaggcctacaggttcgggggacactaccttcgt
gtcaaagccccagccaagcctggagatgagggcaaggtggagcagggcatgaaggactcc
aagtccctgagtttgccgattctgcggccagctgggaccgggccccccgccctggagcgt
gtggacgcccagagccgccgggagagcctggacatcttggcccctggccgccgccgcaag
aacatgtcggagttcctgggggaggcgagcatccccgggcaggagccccccacgccctcc
agctgctctctgcccagcggcagcagtggcagcaccaacactggcgacagctggaagaac
cgggcggccagtcgcttcagcggctttttcagctccggccccagcaccagcgcctttggc
cgggaggtagacaagatggagcagctggagggcaagctgcacacctacagcctcttcggg
ctgcccaggctgccccgggggctgcgcttcgaccatgactcctgggaggaggagtacgat
gaagacgaggatgaggacaatgcctgcctgaggctggaggacagctggcgggagctcatt
gatgggcatgagaagctgacccggcggcagtgccaccagcaggaggcggtgtgggagctg
ctgcacacggaggcctcctacatcaggaaactgcgggtgatcatcaacctgttcctgtgc
tgcctcctgaacctgcaagagtcagggctgctgtgtgaggtggaggcggagcgcctgttc
agcaacatcccggagatcgcgcagctgcaccgcaggctgtgggctagcgtgatggcgccg
gtgctggagaaggcgcggcgcacgcgagcgctgctacagcccggggacttcctcaaaggc
ttcaagatgttcggctcgctcttcaagccctacatccgctactgcatggaggaggagggc
tgcatggagtacatgcgcggcctgctgcgcgacaacgacctcttccgggcctacatcacg
tgggcggagaagcacccacagtgccagaggctgaagctgagcgacatgctggccaaaccc
caccagcggctcaccaagtacccgctgctgctcaagtcggtgctgaggaagaccgaggag
ccgcgcgccaaggaggccgtcgtcgccatgatcggctccgtggagcgcttcatccaccac
gtgaacgcgtgcatgcggcagcggcaggagcggcagcggctggcggccgtggtgagccgc
atcgacgcctacgaggtggtggaaagcagcagcgacgaagtggacaagctcctgaaggaa
tttctgcacctggacttgacagcgcccatccctggcgcctccccggaggagacgcggcag
ctgctgctggaggggagcctgaggatgaaggaggggaaggacagcaagatggatgtgtac
tgcttcctcttcacggatctgctgttggtgaccaaagcagtgaagaaggcagagaggacc
agggtcatcaggccacccctgctcgtggacaagattgtgtgccgggagctacgggaccct
gggtccttcctccttatctacctgaatgagtttcacagtgctgtaggggcctacacgttc
caggccagtggccaggccttgtgccgtggctgggtggacaccatttacaatgcccagaac
cagctgcaacagctgcgtgcacaggagcccccaggcagtcagcagcccctgcagagcctg
gaagaggaggaggatgagcaggaggaggaagaggaggaggaggaggaggaggaggaaggc
gaggacagtggcacttcagctgccagctcccctaccatcatgcggaaaagcagcggcagc
cccgactctcagcactgtgcctcagatggctccacggagaccctggccatggttgtggta
gagcctggggacacgctgtcctcccccgagttcgacagcggtcctttcagctcccagtct
gatgagacctctctcagcaccactgcctcatctgccacgcccaccagtgagctgctgccc
ctgggtccggtggacggccgctcctgctccatggactctgcctacggcaccctctcccca
acctccttacaagactttgtggccccaggcccaatggcagagctagtgcctcgggcccca
gagtccccacgagttccttcccctccaccctcgccccgtctccgccgccgcacccctgtc
cagctgttgagctgcccgccccacctgctcaagtctaagtccgaggccagcctcctccag
ctgctggcaggggctggcacccatgggacaccctctgcccccagccgcagcctgtcagag
ctctgcctggctgttccagccccaggtattaggactcagggctcccctcaggaagctggg
cccagctgggattgccgaggggcccctagccctggcagcggtcctgggctagtcggctgc
ctggccggggaacctgcaggctcccacaggaagaggtgtggagacctgccctcgggggcc
tctcccagggtccagcctgagcccccaccaggggtctctgcccagcacaggaagctgacc
ctggcccagctctaccgaatcaggaccaccctgctgcttaactccacgctcactgcctcg
gaggtctga

DBGET integrated database retrieval system