KEGG   Homo sapiens (human): 5745Help
Entry
5745              CDS       T01001                                 

Gene name
PTH1R, EKNS, PFE, PTHR, PTHR1
Definition
(RefSeq) parathyroid hormone 1 receptor
  KO
K04585  parathyroid hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
Network
nt06318  CaSR-PTH signaling
  Element
N00288  PTH-PTH1R-PKA signaling pathway
N00289  Mutation-inactivated GNAS to PTH-PTH1R-PKA signaling pathway
Disease
H00479  Metaphyseal dysplasias
H00495  Eiken dysplasia
H00508  Blomstrand syndrome
H00680  Primary failure of tooth eruption
Drug target
Abaloparatide (DG03050): D10885 D11563
Parathyroid hormone: D05364
Teriparatide (DG00512): D03358 D06078 D06546
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5745 (PTH1R)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5745 (PTH1R)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5745 (PTH1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5745 (PTH1R)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Calcium-regulating peptide
   Parathyroid hormone
    5745 (PTH1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 5745
NCBI-ProteinID: NP_000307
OMIM: 168468
HGNC: 9608
Ensembl: ENSG00000160801
Vega: OTTHUMG00000133515
Pharos: Q03431(Tclin)
UniProt: Q03431 A0A024R2Z8
LinkDB All DBs
Structure
PDB: 

Position
3p21.31
AA seq 593 aa AA seqDB search
MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPA
SIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETRE
REVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVK
DAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK
WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH
YIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKP
GTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcccggatcgcacccggcctggcgctcctgctctgctgccccgtgctcagc
tccgcgtacgcgctggtggatgcagatgacgtcatgactaaagaggaacagatcttcctg
ctgcaccgtgctcaggcccagtgcgaaaaacggctcaaggaggtcctgcagaggccagcc
agcataatggaatcagacaagggatggacatctgcgtccacatcagggaagcccaggaaa
gataaggcatctgggaagctctaccctgagtctgaggaggacaaggaggcacccactggc
agcaggtaccgagggcgcccctgtctgccggaatgggaccacatcctgtgctggccgctg
ggggcaccaggtgaggtggtggctgtgccctgtccggactacatttatgacttcaatcac
aaaggccatgcctaccgacgctgtgaccgcaatggcagctgggagctggtgcctgggcac
aacaggacgtgggccaactacagcgagtgtgtcaaatttctcaccaatgagactcgtgaa
cgggaggtgtttgaccgcctgggcatgatttacaccgtgggctactccgtgtccctggcg
tccctcaccgtagctgtgctcatcctggcctactttaggcggctgcactgcacgcgcaac
tacatccacatgcacctgttcctgtccttcatgctgcgcgccgtgagcatcttcgtcaag
gacgctgtgctctactctggcgccacgcttgatgaggctgagcgcctcaccgaggaggag
ctgcgcgccatcgcccaggcgcccccgccgcctgccaccgccgctgccggctacgcgggc
tgcagggtggctgtgaccttcttcctttacttcctggccaccaactactactggattctg
gtggaggggctgtacctgcacagcctcatcttcatggccttcttctcagagaagaagtac
ctgtggggcttcacagtcttcggctggggtctgcccgctgtcttcgtggctgtgtgggtc
agtgtcagagctaccctggccaacaccgggtgctgggacttgagctccgggaacaaaaag
tggatcatccaggtgcccatcctggcctccattgtgctcaacttcatcctcttcatcaat
atcgtccgggtgctcgccaccaagctgcgggagaccaacgccggccggtgtgacacacgg
cagcagtaccggaagctgctcaaatccacgctggtgctcatgcccctctttggcgtccac
tacattgtcttcatggccacaccatacaccgaggtctcagggacgctctggcaagtccag
atgcactatgagatgctcttcaactccttccagggattttttgtcgcaatcatatactgt
ttctgcaatggcgaggtacaagctgagatcaagaaatcttggagccgctggacactggca
ctggacttcaagcgaaaggcacgcagcgggagcagcagctatagctacggccccatggtg
tcccacacaagtgtgaccaatgtcggcccccgtgtgggactcggcctgcccctcagcccc
cgcctactgcccactgccaccaccaacggccaccctcagctgcctggccatgccaagcca
gggaccccagccctggagaccctcgagaccacaccacctgccatggctgctcccaaggac
gatgggttcctcaacggctcctgctcaggcctggacgaggaggcctctgggcctgagcgg
ccacctgccctgctacaggaagagtgggagacagtcatgtga

DBGET integrated database retrieval system