KEGG   Homo sapiens (human): 5746
Entry
5746              CDS       T01001                                 

Gene name
PTH2R, PTHR2
Definition
(RefSeq) parathyroid hormone 2 receptor
  KO
K04586  parathyroid hormone receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Parathyroid hormone: D05364
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5746 (PTH2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5746 (PTH2R)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Calcium-regulating peptide
   Parathyroid hormone
    5746 (PTH2R)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 5746
NCBI-ProteinID: NP_005039
OMIM: 601469
HGNC: 9609
Ensembl: ENSG00000144407
Vega: OTTHUMG00000132960
Pharos: P49190(Tchem)
UniProt: P49190
LinkDB
Position
2q34
AA seq 550 aa
MAGLGASLHVWGWLMLGSCLLARAQLDSDGTITIEEQIVLVLKAKVQCELNITAQLQEGE
GNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWA
NYSDCLRFLQPDISIGKQEFFERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIH
MHLFVSFMLRATSIFVKDRVVHAHIGVKELESLIMQDDPQNSIEATSVDKSQYIGCKIAV
VMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTKYLWGFILIGWGFPAAFVAAWAVARAT
LADARCWELSAGDIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDTRKQYRK
LAKSTLVLVLVFGVHYIVFVCLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGEV
QAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAK
IASRQPDSHITLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTE
GCQGETEDVL
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggccgggctgggggcgtcgctccacgtctggggttggctaatgctcggcagctgcctc
ctggccagagcccagctggattctgatggcaccattactatagaggagcagattgtcctt
gtgctgaaagcgaaagtacaatgtgaactcaacatcacagctcaactccaggagggagaa
ggtaattgtttccctgaatgggatggactcatttgttggcccagaggaacagtggggaaa
atatcggctgttccatgccctccttatatttatgacttcaaccataaaggagttgctttc
cgacactgtaaccccaatggaacatgggattttatgcacagcttaaataaaacatgggcc
aattattcagactgccttcgctttctgcagccagatatcagcataggaaagcaagaattc
tttgaacgcctctatgtaatgtataccgttggctactccatctcttttggttccttggct
gtggctattctcatcattggttacttcagacgattgcattgcactaggaactatatccac
atgcacttatttgtgtctttcatgctgagagctacaagcatctttgtcaaagacagagta
gtccatgctcacataggagtaaaggagctggagtccctaataatgcaggatgacccacaa
aattccattgaggcaacttctgtggacaaatcacaatatatcgggtgcaagattgctgtt
gtgatgtttatttacttcctggctacaaattattattggatcctggtggaaggtctctac
ctgcataatctcatctttgtggctttcttttcggacaccaaatacctgtggggcttcatc
ttgataggctgggggtttccagcagcatttgttgcagcatgggctgtggcacgagcaact
ctggctgatgcgaggtgctgggaacttagtgctggagacatcaagtggatttatcaagca
ccgatcttagcagctattgggctgaattttattctgtttctgaatacggttagagttcta
gctaccaaaatctgggagaccaatgcagttgggcatgacacaaggaagcaatacaggaaa
ctggccaaatcgacactggtcctggtcctagtctttggagtgcattacatcgtgttcgta
tgcctgcctcactccttcactgggctcgggtgggagatccgcatgcactgtgagctcttc
ttcaactcctttcagggtttctttgtgtctatcatctactgctactgcaatggagaggtt
caggcagaggtgaagaagatgtggagtcggtggaacctctccgtggactggaaaaggaca
ccgccatgtggcagccgcagatgcggctcagtgctcaccaccgtgacgcacagcaccagc
agccagtcacaggtggcggccagcacacgcatggtgcttatctctggcaaagctgccaag
atcgccagcagacagcctgacagccacatcactttacctggctatgtctggagtaactca
gagcaggactgcctgccacactctttccacgaggagaccaaggaagatagtgggaggcag
ggagatgatattctaatggagaagccttccaggcctatggaatctaacccagacactgaa
ggatgccaaggagaaactgaggatgttctctga

DBGET integrated database retrieval system