KEGG   Homo sapiens (human): 57491
Entry
57491             CDS       T01001                                 

Gene name
AHRR, AHH, AHHR, bHLHe77
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57491 (AHRR)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    57491 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 57491
NCBI-ProteinID: NP_001364165
OMIM: 606517
HGNC: 346
Ensembl: ENSG00000286169
Vega: OTTHUMG00000162171
Pharos: A9YTQ3(Tbio)
LinkDB
Structure
PDB: 
5Y7Y

Position
5p15.33
AA seq 697 aa
MIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLN
GFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQV
VFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATA
DAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCLRGGP
DLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRLQPSK
NDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPL
CHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSG
CEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRA
TAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPL
DSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggagtgcacgtacgcgggccggaagcggaggaggcccctgcagaaa
cagaggcccgccgtgggggcagagaagtccaacccctccaagcgacaccgggaccgcctc
aacgccgagttggaccacctggccagcctgctgccgttcccgcctgacatcatctccaag
ctggacaagctttctgtcctgcgcctcagtgtcagttacctccgggtgaagagcttcttc
caagtcgtgcaggagcagagctcacggcagcctgcggccggcgccccctcgcccggagac
agctgtcctcttgcagggtctgccgtgctggagggaaggctgctgttggagtctcttaat
ggctttgctctggtcgtgagtgcagaagggacgatattttatgcatcagcaacgatcgtg
gactatctgggcttccatcagacggatgtaatgcaccagaacatttatgactacatccac
gtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccaggtg
gtgtttgggcagcccccgcccttggagacaggagatgatgctatcctggggaggctgctc
agggcccaggagtggggcacaggcacgcccaccgagtactcggccttcctgacccgctgc
ttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caaggaaaactaaaattcctgtttggacagaagaagaaggcgccgtcaggagccatgctc
ccgccgcggctgtcgctgttctgcattgcggcacccgttctcctcccctccgcagcggag
atgaaaatgaggagcgcgctcctgagggcaaaacccagagcagacaccgcagccaccgcg
gatgcaaaagtaaaagccaccaccagtctgtgcgaatcggaactgcatggaaaacccaat
tactcagcaggaaggagcagcagagagagcggcgttttggtgctcagggaacagactgac
gctggccgatgggcacaggttcccgccagggccccatgcctgtgcctccggggtggccct
gaccttgtccttgaccccaaggggggctcaggggacagggaggaggagcagcacaggatg
ctgagcagggcctctggagtgacagggcggagggagactccaggacccacaaagcccctg
ccctggacagcgggaaagcacagtgaggatggtgccaggccgaggctgcagcccagcaag
aatgacccgccctccctgcgccccatgccccgcggctcctgcctgccctgcccgtgtgtc
cagggcactttcaggaactcgcccatctctcacccgccgagcccgtcccccagtgcctac
tccagccggaccagcagacccatgcgggatgtcggtgaggaccaggtgcaccctcccctc
tgccactttccccagaggagcctgcagcaccagctccctcagcctggagctcagcgtttt
gccacgaggggctatcccatggaggacatgaagctgcaaggtgtaccgatgcctccgggg
gacctgtgtggtccgacgctgctgctagatgtgtccatcaagatggagaaggactctggg
tgtgagggtgctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgacagg
agccacccagccaccttccctaccaggatgcacctgaaaacagagccagactctcggcaa
caggtgtacatctcgcacctggggcacggcgtgcggggggctcagccccatgggagggcc
actgctgggcgcagcagggagctgacccctttccaccctgcacactgtgcctgcctggag
cccacagacggccttccccagtcggagcctccccaccagctctgtgcacggggccgaggt
gaacagtcctgcacctgcagagctgctgaggccgcccctgtggtcaagcgggagcccttg
gactcaccccagtgggctactcacagccagggaatggtgcccgggatgttgcccaaaagt
gccttggccacgctggtcccgccccaagcttcggggtgcacattcctgccatag

DBGET integrated database retrieval system