KEGG   Homo sapiens (human): 57506Help
Entry
57506             CDS       T01001                                 

Gene name
MAVS, CARDIF, IPS-1, IPS1, VISA
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
Network
nt06133  RIG-I signaling (virus)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06263  Hepatocellular carcinoma
  Element
N00268  HBV HBx to RIG-I-like receptor signaling pathway
N00271  HCV NS3/4A to RIG-I-like receptor signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00685  MV V to RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00727  IAV NS1 to RIG-I-like receptor signaling pathway
N00728  IAV NS1 to RIG-I-like receptor signaling pathway
N00732  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    57506 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    57506 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    57506 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    57506 (MAVS)
   05164 Influenza A
    57506 (MAVS)
   05161 Hepatitis B
    57506 (MAVS)
   05160 Hepatitis C
    57506 (MAVS)
   05168 Herpes simplex virus 1 infection
    57506 (MAVS)
   05169 Epstein-Barr virus infection
    57506 (MAVS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2
Motif
Other DBs
NCBI-GeneID: 57506
NCBI-ProteinID: NP_065797
OMIM: 609676
HGNC: 29233
Ensembl: ENSG00000088888
Vega: OTTHUMG00000031765
Pharos: Q7Z434(Tbio)
UniProt: Q7Z434
LinkDB All DBs
Structure
PDB: 

Position
20p13
AA seq 540 aa AA seqDB search
MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPP
TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLES
SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRL
PGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVP
SKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLE
GNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgctgaagacaagacctataagtatatctgccgcaatttcagcaatttttgc
aatgtggatgttgtagagattctgccttacctgccctgcctcacagcaagagaccaggat
cgactgcgggccacctgcacactctcagggaaccgggacaccctctggcatctcttcaat
acccttcagcggcggcccggctgggtggagtacttcattgcggcactgaggggctgtgag
ctagttgatctcgcggacgaagtggcctctgtctaccagagctaccagcctcggacctcg
gaccgtcccccagacccactggagccaccgtcacttcctgctgagaggccagggcccccc
acacctgctgcggcccacagcatcccctacaacagctgcagagagaaggagccaagttac
cccatgcctgtccaggagacccaggcgccagagtccccaggagagaattcagagcaagcc
ctgcagacgctcagccccagagccatcccaaggaatccagatggtggccccctggagtcc
tcctctgacctggcagccctcagccctctgacctccagcgggcatcaggagcaggacaca
gaactgggcagtacccacacagcaggtgcgacctccagcctcacaccatcccgtgggcct
gtgtctccatctgtctccttccagcccctggcccgttccacccccagggcaagccgcttg
cctggacccacagggtcagttgtatctactggcacctccttctcctcctcatcccctggc
ttggcctctgcaggggctgcagagggtaaacagggtgcagagagtgaccaggccgagcct
atcatctgctccagtggggcagaggcacctgccaactctctgccctccaaagtgcctacc
accttgatgcctgtgaacacagtggccctgaaagtgcctgccaacccagcatctgtcagc
acagtgccctccaagttgccaactagctcaaagccccctggtgcagtgccttctaatgcg
ctcaccaatccagcaccatccaaattgcccatcaactcaacccgtgctggcatggtgcca
tccaaagtgcctactagcatggtgctcaccaaggtgtctgccagcacagtccccactgac
gggagcagcagaaatgaggagaccccagcagctccaacacccgccggcgccactggaggc
agctcagcctggctagacagcagctctgagaataggggccttgggtcggagctgagtaag
cctggcgtgctggcatcccaggtagacagcccgttctcgggctgcttcgaggatcttgcc
atcagtgccagcacctccttgggcatggggccctgccatggcccagaggagaatgagtat
aagtccgagggcacctttgggatccacgtggctgagaaccccagcatccagctcctggag
ggcaaccctgggccacctgcggacccggatggcggccccaggccacaagccgaccggaag
ttccaggagagggaggtgccatgccacaggccctcacctggggctctgtggctccaggtg
gctgtgacaggggtgctggtagtcacactcctggtggtgctgtaccggcggcgtctgcac
tag

DBGET integrated database retrieval system