KEGG   Homo sapiens (human): 57615Help
Entry
57615             CDS       T01001                                 

Gene name
ZNF492, ZNF115
Definition
(RefSeq) zinc finger protein 492
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    57615 (ZNF492)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57615 (ZNF492)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    57615 (ZNF492)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 XPA_N zf-C2H2_jaz zf_UBZ Zn-ribbon_8 zf-C2H2_11 BolA Evr1_Alr C1_4 ADK_lid KRAB ISK_Channel zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 57615
NCBI-ProteinID: NP_065906
HGNC: 23707
Ensembl: ENSG00000229676
Vega: OTTHUMG00000182987
Pharos: Q9P255(Tdark)
UniProt: Q9P255
LinkDB All DBs
Position
19p12
AA seq 531 aa AA seqDB search
MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKK
NYFQKVILRRYKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVK
VFHKFSNSNRHTIRHTGKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNE
TSNLSTHKRIHTGKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANL
TTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHK
IIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHA
GEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP
YKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCE
ECGKAFNNSSILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttagagaactacagaaacctggtcttcgtgggtattgctgcctctaagccagacctg
atcacctgtctggagcaaggaaaagaaccttggaatgtgaagagacatgagatggtagct
gaacccccagttgtatgttcttattttgcccgagacctttggccaaagcagggcaaaaaa
aattatttccaaaaagtgatactgagaagatataaaaaatgtggatgtgaaaatttacag
ttaagaaaatactgtaaaagcatggatgagtgtaaggtgcacaaagaatgttacaatgga
cttaaccagtgtttgacgactacccagaacaaaatatttcaatgtgacaaatatgtgaaa
gtctttcataaattttcaaattcaaacagacatacgataagacatactggaaagaaatct
ttcaaatgtaaagaatgtgaaaagtcattttgcatgctttcacacttagctcaacataaa
agaattcatagtggagagaaaccctacaaatgtaaagaatgtgggaaagcctataatgag
acctcaaacctttctacacataaaagaattcatactggaaagaaaccctacaaatgcgaa
gagtgtggaaaagcctttaaccggctctcacaccttactacacataagataattcatact
ggaaagaaaccctacaaatgtgaggagtgtggcaaagcttttaaccaatctgcaaacctt
actacacataagagaattcatactggagagaaaccctacaaatgtgaagaatgtggcaga
gcttttagccagtcctcaacccttactgcacataagataattcatgctggagagaaacct
tacaaatgtgaagaatgtggcaaagcttttagccagtcctcaacccttactacacataag
ataattcatactggagagaaattctacaaatgtgaagaatgtggtaaggcctttagccag
ttatcccaccttactacacataagagaattcattctggagagaaaccctacaagtgtgaa
gaatgtggcaaagcttttaaacaatcctcaacccttactacacataagagaattcatgct
ggagagaaattctacaaatgtgaagtatgtagcaaagcctttagccggttctcacacctt
actacacataagagaattcatactggagagaagccctacaaatgtgaagaatgtggcaaa
gcttttaacctatcgtcacaacttactacacataagataattcatactggagagaaaccc
tacaaatgtgaagaatgtggcaaagcttttaaccagtcctcaactctttctaaacataag
gtaattcatactggagagaagccctacaaatatgaagaatgtggcaaagcttttaaccag
tcctcacaccttactacacataagatgattcatactggagagaaaccctacaagtgtgaa
gaatgtggcaaagcctttaacaactcctctattcttaacagacataagatgattcatact
ggagagaaactctacaaacctgaaagttgtaacaatgcttgtgacaacattgcaaagatt
tccaaatataaaagaaattgtgctggtgagaaataa

DBGET integrated database retrieval system