KEGG   Homo sapiens (human): 57620Help
Entry
57620             CDS       T01001                                 

Gene name
STIM2
Definition
(RefSeq) stromal interaction molecule 2
  KO
K18196  stromal interaction molecule 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    57620 (STIM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57620 (STIM2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   57620 (STIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOAR SAM_2 SAM_1 SAM_Ste50p ESSS DUF4446
Motif
Other DBs
NCBI-GeneID: 57620
NCBI-ProteinID: NP_065911
OMIM: 610841
HGNC: 19205
Ensembl: ENSG00000109689
Vega: OTTHUMG00000097805
Pharos: Q9P246(Tbio)
UniProt: Q9P246 B3KUB5
LinkDB All DBs
Structure
PDB: 

Position
4p15.2
AA seq 746 aa AA seqDB search
MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPC
FTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHIT
IEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
SQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKT
SKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHE
VEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGG
VDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSH
PRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETK
SMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSI
PHDLCHNGEKSKKPSKIKSLFKKKSK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
ttgctggtgctcgggctgctggtagccggagcggcggacggatgcgagcttgtgccccgg
cacctccgcgggcggcgggcgactggctctgccgcaactgccgcctcctctcccgccgcg
gcggccggcgatagcccggcgctcatgacagatccctgcatgtcactgagtccaccatgc
tttacagaagaagacagatttagtctggaagctcttcaaacaatacataaacaaatggat
gatgacaaagatggtggaattgaagtagaggaaagtgatgaattcatcagagaagatatg
aaatataaagatgctactaataaacacagccatctgcacagagaagataaacatataacg
attgaggatttatggaaacgatggaaaacatcagaagttcataattggacccttgaagac
actcttcagtggttgatagagtttgttgaactaccccaatatgagaagaattttagagac
aacaatgtcaaaggaacgacacttcccaggatagcagtgcacgaaccttcatttatgatc
tcccagttgaaaatcagtgaccggagtcacagacaaaaacttcagctcaaggcattggat
gtggttttgtttggacctctaacacgcccacctcataactggatgaaagattttatcctc
acagtttctatagtaattggtgttggaggctgctggtttgcttatacgcagaataagaca
tcaaaagaacatgttgcaaaaatgatgaaagatttagagagcttacaaactgcagagcaa
agtctaatggacttacaggagaggcttgaaaaggcacaggaagaaaacagaaatgttgct
gtagaaaagcaaaatttagagcgcaaaatgatggatgaaatcaattatgcaaaggaggag
gcttgtcggctgagagagctaagggagggagctgaatgtgaattgagtagacgtcagtat
gcagaacaggaattggaacaggttcgcatggctctgaaaaaggccgaaaaagaatttgaa
ctgagaagcagttggtctgttccagatgcacttcagaaatggcttcagttaacacatgaa
gtagaagtgcaatactacaatattaaaagacaaaacgctgaaatgcagctagctattgct
aaagatgaggcagaaaaaattaaaaagaagagaagcacagtctttgggactctgcacgtt
gcacacagctcctccctagatgaggtagaccacaaaattctggaagcaaagaaagctctc
tctgagttgacaacttgtttacgagaacgactttttcgctggcaacaaattgagaagatc
tgtggctttcagatagcccataactcaggactccccagcctgacctcttccctttattct
gatcacagctgggtggtgatgcccagagtctccattccaccctatccaattgctggagga
gttgatgacttagatgaagacacacccccaatagtgtcacaatttcccgggaccatggct
aaacctcctggatcattagccagaagcagcagcctgtgccgttcacgccgcagcattgtg
ccgtcctcgcctcagcctcagcgagctcagcttgctccacacgccccccacccgtcacac
cctcggcaccctcaccacccgcaacacacaccacactccttgccttcccctgatccagat
atcctctcagtgtcaagttgccctgcgctttatcgaaatgaagaggaggaagaggccatt
tacttctctgctgaaaagcaatgggaagtgccagacacagcttcagaatgtgactcctta
aattcttccattggaaggaaacagtctcctcctttaagcctcgagatataccaaacatta
tctccgcgaaagatatcaagagatgaggtgtccctagaggattcctcccgaggggattcg
cctgtaactgtggatgtgtcttggggttctcccgactgtgtaggtctgacagaaactaag
agtatgatcttcagtcctgcaagcaaagtgtacaatggcattttggagaaatcctgtagc
atgaaccagctttccagtggcatcccggtgcctaaacctcgccacacatcatgttcctca
gctggcaacgacagtaaaccagttcaggaagccccaagtgttgccagaataagcagcatc
ccacatgacctttgtcataatggagagaaaagcaaaaagccatcaaaaatcaaaagcctt
tttaagaagaaatctaagtga

KEGG   Homo sapiens (human): 6786Help
Entry
6786              CDS       T01001                                 

Gene name
STIM1, D11S4896E, GOK, IMD10, STRMK, TAM, TAM1
Definition
(RefSeq) stromal interaction molecule 1
  KO
K16059  stromal interaction molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04611  Platelet activation
Disease
H00093  Combined immunodeficiency
H02258  Tubular aggregate myopathy
H02259  Stormorken syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    6786 (STIM1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6786 (STIM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6786 (STIM1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   6786 (STIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOAR SAM_2 SAM_1 SAM_Ste50p Prominin
Motif
Other DBs
NCBI-GeneID: 6786
NCBI-ProteinID: NP_003147
OMIM: 605921
HGNC: 11386
Ensembl: ENSG00000167323
Vega: OTTHUMG00000133360
Pharos: Q13586(Tbio)
UniProt: Q13586
LinkDB All DBs
Structure
PDB: 

Position
11p15.4
AA seq 685 aa AA seqDB search
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatgtatgcgtccgtcttgccctgtggctcctctggggactcctcctgcaccagggc
cagagcctcagccatagtcacagtgagaaggcgacaggaaccagctcgggggccaactct
gaggagtccactgcagcagagttttgccgaattgacaagcccctgtgtcacagtgaggat
gagaaactcagcttcgaggcagtccgtaacatccacaaactgatggacgatgatgccaat
ggtgatgtggatgtggaagaaagtgatgagttcctgagggaagacctcaattaccatgac
ccaacagtgaaacacagcaccttccatggtgaggataagctcatcagcgtggaggacctg
tggaaggcatggaagtcatcagaagtatacaattggaccgtggatgaggtggtacagtgg
ctgatcacatatgtggagctgcctcagtatgaggagaccttccggaagctgcagctcagt
ggccatgccatgccaaggctggctgtcaccaacaccaccatgacagggactgtgctgaag
atgacagaccggagtcatcggcagaagctgcagctgaaggctctggatacagtgctcttt
gggcctcctctcttgactcgccataatcacctcaaggacttcatgctggtggtgtctatc
gttattggtgtgggcggctgctggtttgcctatatccagaaccgttactccaaggagcac
atgaagaagatgatgaaggacttggaggggttacaccgagctgagcagagtctgcatgac
cttcaggaaaggctgcacaaggcccaggaggagcaccgcacagtggaggtggagaaggtc
catctggaaaagaagctgcgcgatgagatcaaccttgctaagcaggaagcccagcggctg
aaggagctgcgggagggtactgagaatgagcggagccgccaaaaatatgctgaggaggag
ttggagcaggttcgggaggccttgaggaaagcagagaaggagctagaatctcacagctca
tggtatgctccagaggcccttcagaagtggctgcagctgacacatgaggtggaggtgcaa
tattacaacatcaagaagcaaaatgctgagaagcagctgctggtggccaaggagggggct
gagaagataaaaaagaagagaaacacactctttggcaccttccacgtggcccacagctct
tccctggatgatgtagatcataaaattctaacagctaagcaagcactgagcgaggtgaca
gcagcattgcgggagcgcctgcaccgctggcaacagatcgagatcctctgtggcttccag
attgtcaacaaccctggcatccactcactggtggctgccctcaacatagaccccagctgg
atgggcagtacacgccccaaccctgctcacttcatcatgactgacgacgtggatgacatg
gatgaggagattgtgtctcccttgtccatgcagtcccctagcctgcagagcagtgttcgg
cagcgcctgacggagccacagcatggcctgggatctcagagggatttgacccattccgat
tcggagtcctccctccacatgagtgaccgccagcgtgtggcccccaaacctcctcagatg
agccgtgctgcagacgaggctctcaatgccatgacttccaatggcagccaccggctgatc
gagggggtccacccagggtctctggtggagaaactgcctgacagccctgccctggccaag
aaggcattactggcgctgaaccatgggctggacaaggcccacagcctgatggagctgagc
ccctcagccccacctggtggctctccacatttggattcttcccgttctcacagccccagc
tccccagacccagacacaccatctccagttggggacagccgagccctgcaagccagccga
aacacacgcattccccacctggctggcaagaaggctgtggctgaggaggataatggctct
attggcgaggaaacagactccagcccaggccggaagaagtttcccctcaaaatctttaag
aagcctcttaagaagtag

DBGET integrated database retrieval system