KEGG   Homo sapiens (human): 57689Help
Entry
57689             CDS       T01001                                 

Gene name
LRRC4C, NGL-1, NGL1
Definition
(RefSeq) leucine rich repeat containing 4C
  KO
K07523  netrin-G1 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    57689 (LRRC4C)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    57689 (LRRC4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig LRR_9 V-set Ig_2 Ig_6 LRR_1 LRRNT Podoplanin Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 57689
NCBI-ProteinID: NP_001245348
OMIM: 608817
HGNC: 29317
Ensembl: ENSG00000148948
Vega: OTTHUMG00000166383
Pharos: Q9HCJ2(Tbio)
UniProt: Q9HCJ2 Q4JIW0 Q4JIV9
LinkDB All DBs
Structure
PDB: 

Position
11p12
AA seq 640 aa AA seqDB search
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccctatttgaccccctgcttgtggtgctgctggctcttcaacttcttgtggtggctggt
ctggtgcgggctcagacctgcccttctgtgtgctcctgcagcaaccagttcagcaaggtg
atttgtgttcggaaaaacctgcgtgaggttccggatggcatctccaccaacacacggctg
ctgaacctccatgagaaccaaatccagatcatcaaagtgaacagcttcaagcacttgaga
cacttggaaatcctacagttgagtaggaaccatatcagaaccattgaaattggggctttc
aatggtctggcgaacctcaacactctggaactctttgacaatcgtcttactaccatcccg
aatggagcttttgtatacttgtctaaactgaaggagctctggttgcgaaacaaccccatt
gaaagcatcccttcttatgcttttaacagaattccttctttgcgccgactagacttaggg
gaattgaaaagactttcatacatctcagaaggtgcctttgaaggtctgtccaacttgagg
tatttgaaccttgccatgtgcaaccttcgggaaatccctaacctcacaccgctcataaaa
ctagatgagctggatctttctgggaatcatttatctgccatcaggcctggctctttccag
ggtttgatgcaccttcaaaaactgtggatgatacagtcccagattcaagtgattgaacgg
aatgcctttgacaaccttcagtcactagtggagatcaacctggcacacaataatctaaca
ttactgcctcatgacctcttcactcccttgcatcatctagagcggatacatttacatcac
aacccttggaactgtaactgtgacatactgtggctcagctggtggataaaagacatggcc
ccctcgaacacagcttgttgtgcccggtgtaacactcctcccaatctaaaggggaggtac
attggagagctcgaccagaattacttcacatgctatgctccggtgattgtggagccccct
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcctccacatcc
ctgacatctgtatcttggattactccaaatggaacagtcatgacacatggggcgtacaaa
gtgcggatagctgtgctcagtgatggtacgttaaatttcacaaatgtaactgtgcaagat
acaggcatgtacacatgtatggtgagtaattccgttgggaatactactgcttcagccacc
ctgaatgttactgcagcaaccactactcctttctcttacttttcaaccgtcacagtagag
actatggaaccgtctcaggatgaggcacggaccacagataacaatgtgggtcccactcca
gtggtcgactgggagaccaccaatgtgaccacctctctcacaccacagagcacaaggtcg
acagagaaaaccttcaccatcccagtgactgatataaacagtgggatcccaggaattgat
gaggtcatgaagactaccaaaatcatcattgggtgttttgtggccatcacactcatggct
gcagtgatgctggtcattttctacaagatgaggaagcagcaccatcggcaaaaccatcac
gccccaacaaggactgttgaaattattaatgtggatgatgagattacgggagacacaccc
atggaaagccacctgcccatgcctgctatcgagcatgagcacctaaatcactataactca
tacaaatctcccttcaaccacacaacaacagttaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccgaatgaactctaaagacaatgtacaagagactcaaatc
taa

DBGET integrated database retrieval system