KEGG   Homo sapiens (human): 5771Help
Entry
5771              CDS       T01001                                 

Gene name
PTPN2, PTN2, PTPT, TC-PTP, TCELLPTP, TCPTP
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
Disease
H00408  Type 1 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    5771 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5771 (PTPN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5771 (PTPN2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5771 (PTPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc CHASE3 Synaptobrevin LAP1C IKKbetaNEMObind Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 5771
NCBI-ProteinID: NP_002819
OMIM: 176887
HGNC: 9650
Ensembl: ENSG00000175354
Vega: OTTHUMG00000131702
Pharos: P17706(Tchem)
UniProt: P17706 Q59F91
LinkDB All DBs
Structure
PDB: 

Position
18p11.21
AA seq 415 aa AA seqDB search
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaccatcgagcgggagttcgaagagttggatactcagcgtcgctggcagccg
ctgtacttggaaattcgaaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaaatgctgagaatgattatattaatgccagtttagttgacatagaagaggcacaa
aggagttacatcttaacacagggtccacttcctaacacatgctgccatttctggcttatg
gtttggcagcagaagaccaaagcagttgtcatgctgaaccgcattgtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccaagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctactacaa
ttagaaaatatcaatagtggtgaaaccagaacaatatctcactttcattatactacctgg
ccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtgaga
gaatctggctccttgaaccctgaccatgggcctgcggtgatccactgtagtgcaggcatt
gggcgctctggcaccttctctctggtagacacttgtcttgttttgatggaaaaaggagat
gatattaacataaaacaagtgttactgaacatgagaaaataccgaatgggtcttattcag
accccagatcaactgagattctcatacatggctataatagaaggagcaaaatgtataaag
ggagattctagtatacagaaacgatggaaagaactttctaaggaagacttatctcctgcc
tttgatcattcaccaaacaaaataatgactgaaaaatacaatgggaacagaataggtcta
gaagaagaaaaactgacaggtgaccgatgtacaggactttcctctaaaatgcaagataca
atggaggagaacagtgagagtgctctacggaaacgtattcgagaggacagaaaggccacc
acagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacgaaaaagaaaa
aggtggttatattggcaacctattctcactaagatggggtttatgtcagtcattttggtt
ggcgcttttgttggctggacactgttttttcagcaaaatgccctataa

DBGET integrated database retrieval system