KEGG   Homo sapiens (human): 57826
Entry
57826             CDS       T01001                                 

Gene name
RAP2C
Definition
(RefSeq) RAP2C, member of RAS oncogene family
  KO
K07839  Ras-related protein Rap-2C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    57826 (RAP2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    57826 (RAP2C)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    57826 (RAP2C)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N TPP_enzyme_M MMR_HSR1_Xtn AAA_24
Other DBs
NCBI-GeneID: 57826
NCBI-ProteinID: NP_001258115
OMIM: 301016
HGNC: 21165
Ensembl: ENSG00000123728
Vega: OTTHUMG00000022424
Pharos: Q9Y3L5(Tbio)
UniProt: Q9Y3L5
LinkDB
Position
Xq26.2
AA seq 183 aa
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDL
EPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTC
VVQ
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagggaatacaaggtagtggtgttagggagtggaggggttggcaaatctgcccttact
gtgcagtttgtcactgggactttcattgagaaatatgaccccaccattgaagatttctac
cgcaaagagatcgaagtggactcttccccctccgtgctggaaattctggacaccgcagga
actgagcagtttgcctccatgagagatctctacatcaaaaacggccaaggtttcatcctg
gtttatagcctggttaatcaacagtcttttcaggatatcaagccaatgagagatcaaatt
gtcagagtgaagagatatgaaaaagtcccactaatcctagtaggaaataaagtggatctg
gaaccagaaagagaggttatgtcttcagaaggcagagctctggctcaagaatggggctgt
cctttcatggagacatcggcaaaaagtaaatcaatggtggatgaactttttgctgagatc
gtcaggcaaatgaactattcatccctgccggagaagcaagatcagtgttgtacaacttgt
gtcgtccagtaa

DBGET integrated database retrieval system